User talk:Dan arndt/Archive 15
Wikipedia Asian Month 2017: Invitation to Participate
editHello! Last year, you signed up to participate in Wikipedia Asian Month (WAM) 2016 on the English Wikipedia. The event was an international success, with hundreds of editors creating thousands of articles on Asian topics across dozens of different language versions of Wikipedia.
I'd like to invite you to join us for Wikipedia Asian Month 2017, which once again lasts through the month of November. The goal is for users to create new articles on Asian-related content, each at least 3,000 bytes and 300 words in length. Editors who create at least four articles will receive a Wikipedia Asian Month postcard!
Also be sure to check out the Wikipedia Asian Art Month affiliate event - creating articles on Asian art topics can get you a Metropolitan Museum of Art postcard!
If you're interested, please sign up here for the English Wikipedia. If you are interested in also working on other language editions of Wikipedia, please visit the meta page to see other participating projects. If you have any questions, please visit our talk page.
Thank you!
- User:SuperHamster and User:Titodutta on behalf of The English Wikipedia WAM Team
This will be the last message you receive from the English Wikipedia WAM team for being a 2016 participant. If you sign up for WAM 2017, you will continue receiving periodic updates on the 2017 event.
WAM Address Collection
editCongratulations! You have more than 4 accepted articles in Wikipedia Asian Month! Please submit your postal mailing address via Google form or email me about that on erick@asianmonth.wiki before the end of Janauary, 2018. The Wikimedia Asian Month team only has access to this form, and we will only share your address with local affiliates to send postcards. All personal data will be destroyed immediately after postcards are sent. Please contact your local organizers if you have any question. We apologize for the delay in sending this form to you, this year we will make sure that you will receive your postcard from WAM. If you've not received a postcard from last year's WAM, Please let us know. All ambassadors will receive an electronic certificate from the team. Be sure to fill out your email if you are enlisted Ambassadors list.
Best, Erick Guan (talk)
WAM Address Collection - 1st reminder
editHi there. This is a reminder to fill the address collection. Sorry for the inconvenience if you did submit the form before. If you still wish to receive the postcard from Wikipedia Asian Month, please submit your postal mailing address via this Google form. This form is only accessed by WAM international team. All personal data will be destroyed immediately after postcards are sent. If you have problems in accessing the google form, you can use Email This User to send your address to my Email.
If you do not wish to share your personal information and do not want to receive the postcard, please let us know at WAM talk page so I will not keep sending reminders to you. Best, Sailesh Patnaik
Confusion in the previous message- WAM
editHello again, I believe the earlier message has created some confusion. If you have already submitted the details in the Google form, it has been accepted, you don't need to submit it again. The earlier reminder is for those who haven't yet submitted their Google form or if they any alternate way to provide their address. I apologize for creating the confusion. Thanks-Sailesh Patnaik
Rollback granted
editHi Dan arndt. After reviewing your request for "rollbacker", I have enabled rollback on your account. Keep in mind these things when going to use rollback:
- Getting rollback is no more momentous than installing Twinkle.
- Rollback should be used to revert clear cases of vandalism only, and not good faith edits.
- Rollback should never be used to edit war.
- If abused, rollback rights can be revoked.
- Use common sense.
If you no longer want rollback, contact me and I'll remove it. Also, for some more information on how to use rollback, see Wikipedia:Administrators' guide/Rollback (even though you're not an admin). I'm sure you'll do great with rollback, but feel free to leave me a message on my talk page if you run into troubles or have any questions about appropriate/inappropriate use of rollback. Thank you for helping to reduce vandalism. Happy editing! Widr (talk) 07:28, 13 April 2018 (UTC)
wow
editpips! attenshun! youre up the ladder sir! not only a tall man, but with pips! (salutes) JarrahTree 08:49, 13 April 2018 (UTC)
New Page Reviewer granted
editHello Dan arndt. Your account has been added to the "New page reviewers
" user group, allowing you to review new pages and mark them as patrolled, tag them for maintenance issues, or in some cases, tag them for deletion. The list of articles awaiting review is located at the New Pages Feed. New page reviewing is a vital function for policing the quality of the encylopedia; if you have not already done so, you must read the new tutorial at New Pages Review, the linked guides and essays, and fully understand the various deletion criteria. If you need more help or wish to discuss the process, please join or start a thread at page reviewer talk.
- URGENT: Please consider helping get the huge backlog down to a manageable number of pages as soon as possible.
- Be nice to new users - they are often not aware of doing anything wrong.
- You will frequently be asked by users to explain why their page is being deleted - be formal and polite in your approach to them too, even if they are not.
- Don't review a page if you are not sure what to do. Just leave it for another reviewer.
- Remember that quality is quintessential to good patrolling. Take your time to patrol each article, there is no rush. Use the message feature and offer basic advice.
The reviewer right does not change your status or how you can edit articles. If you no longer want this user right, you may ask any administrator to remove it for you at any time. In case of abuse or persistent inaccuracy of reviewing, the right can be revoked at any time by an administrator. Alex Shih (talk) 13:00, 13 April 2018 (UTC)
I think the response for my initial effort to add my Music information is was rather harsh and uncalled for. Unacceptable treatment. I think you all are not helpful at all. You need to be exposed for this type of thing and people need to know how difficult it is to work with Wikipedia and how inappropriate and offensive the response. This type of thing needs to be exposed. Instead of helping guide the user, you choose to criticize and attack the user. This will needs to be exposed. You qualify other musicians with half the credentials, yet you single mine out and return a snarky offensive response at my effort. This should be exposed. Wikipedia should be exposed for this type of behavior.
Jdarne01 (talk) 04:14, 17 April 2018 (UTC)
- Jdarne needs a very very careful read of WP:AUTO before being so sensitive - Wikipedia is not a self advertising blog site - it is an online encyclopedia. JarrahTree 04:52, 17 April 2018 (UTC)
Thank you Dan for your review and feedback . Have added the citation of references now and resubmitted. Anildeepk (talk) 03:37, 30 April 2018 (UTC)
A barnstar for you!
editThe Tireless Contributor Barnstar | |
Can you give this post to me. I'm hard working at Wikipedia. If you like and do you think I'm good please give me this post. Thank you Very much. I'm Minimuthu Minimuthu123 (talk) 12:24, 30 April 2018 (UTC) |
A kitten for you!
editI'm sorry for my last message. Actually I was angry with you because of you are always delete my article references. But now I understand you are good man. Actually I'm sorry for that message. I'm really like to create article and It will appear on Wikipedia but I still couldn't do it. Please support me to improve my articles. Please help me and don't remove my article. please. I beg you please please....
A kitten for you!
editCan't you understand my feelings? You and me both are humans. We are like to do different things. Actually my most big hope is this. You are going to broke my hope and like. Please don't do it. I'm trying this since 2015. But I still couldn't publish only one article. Please help me friend. You aren't goat. you are god for us.. :) please help...
Not English
editHi. Please see WP:NPPNE. If you're not sure how to use Google Translate, don't hesitate to ask me. Kudpung กุดผึ้ง (talk) 09:15, 2 May 2018 (UTC)
06:03:57, 7 May 2018 review of submission by Starhistory22
edit
This page and subject is just as notable as the Zodiac murders and all of the other unsolved murders in the USA, especially when committed by multiple parties of felons, as in this case with two known perpetrators according to the camera footage. (Photos are available of the suspects.) The news media even assigned a special name which will be cited by future researchers and become a part of criminal justice history: "The Drag Queen Killers." The "editor" who rejected this page has made a dumb mistake, just as was done years ago when I submitted a page for Pops Haney, the oldest enlisted man at Guadalcanal. I submitted essentially the exact same information -- (always well-referenced because I am a published author) -- that is now up on a Wikipedia page, years LATER, for the "Elmo M. Haney" listing page. I had the same idea years ago, and Wikipedia rejected it. What kind of "editors" do you have and who gave them this kind of arbitrary authority? It is a mistake, but if Wikipedia wants this reputation, so be it. It is exceedingly DUMB to reject this page that I submitted, which is documented by police department archives and the Las Vegas Review Journal archives. It is NOT a "one time news report"! I am not going to do your work for you, Wikipedia, though I freely gave you another good idea that would have improved your level of comprehensiveness in listings. Want to take bets that Wikipedia will eventually wake up and add this page that I have suggested, too, just like it did with Haney? This kind of low-brow "editor" treatment is exactly why Wikipedia has been banned by respectable colleges and has the reputation that it has today. Good luck to you all.
Starhistory22 (talk) 06:03, 7 May 2018 (UTC)
01:41:23, 8 May 2018 review of submission by Anildeepk
edit
Hello , Thank you for your review and suggestions . Citations which was missed earlier have been added and included inline . Kindly review .
Anildeepk (talk) 01:41, 8 May 2018 (UTC)
04:13:51, 8 May 2018 review of submission by Anildeepk
edit
Hello Dan , Thanks for the review . Would you be able to guide on specifics of what delimited a neutral point of view on the subject ? That would help me on editing the same appropriately .
Anildeepk (talk) 04:13, 8 May 2018 (UTC)
12:06:36, 15 May 2018 review of submission by Gypsyjazzartists
edit
Hello, thanks for taking out the time to review the submission. It’s all try about Chris Quinn - search out Chris Quinn Music on YouTube to see him performing at many leading venues and with notable musicians. Anyway, we’ve added about 10 more links for you to check out including links to BBC 2, regional BBC sites, Acoustic Magazine (the uk’s leading authority on acoustic music), theatre gigs he has coming up, reviews from Leadong Music industry wesbiste/magazine and also to his PR company who have him listed on their front page. Hopefully this is enough for you. Thanks,
Gypsyjazzartists (talk) 12:06, 15 May 2018 (UTC)
Hi Dan, I’m an unpaid volunteer/fan who was surprised Chris Quinn - and soon to be added Robin Nolan - don’t have their own Wikipedia pages considering their standing in the world of Jazz. I contacted Gypsy Jaz artists who I known organises tours for both artists and offered to fix this but didn’t think it would be so difficult. Can you suggest how we can get these world class and notable artists accepted having referenced him on BBC radio 2 websites, major theatre websites and major industry magazine articles on their websites. Thanks
01:54:23, 23 May 2018 review of submission by Rob Sherratt
edit- Rob Sherratt (talk · contribs)
I am not requesting a re-review.
I am asking what information should be provided on my User:Rob Sherratt page.
The Wikipedia system prompted me to create one ... I did my best.
But the Wikipedia article and template for a User: page seems to give no guidance.
Rob Sherratt (talk) 01:54, 23 May 2018 (UTC)
06:26:32, 23 May 2018 review of submission by Joannajfernando
edit
kindly let me know the specific reason for decline. i see many other sri lankan entities have their own wiki page, my client just need to have their company wiki page, my client is a well established well known brand in sri lanka. the word "crysbro chicken is a house hold name and requires mentioning as web content in wiki. kindly help.
NPR Newsletter No.11 25 May 2018
editACTRIAL:
- WP:ACREQ has been implemented. The flow at the feed has dropped back to the levels during the trial. However, the backlog is on the rise again so please consider reviewing a few extra articles each day; a backlog approaching 5,000 is still far too high. An effort is also needed to ensure that older unsuitable older pages at the back of the queue do not get automatically indexed for Google.
Deletion tags
- Do bear in mind that articles in the feed showing the trash can icon may have been tagged by inexperienced or non NPR rights holders. They require your further verification.
Backlog drive:
- A backlog drive will take place from 10 through 20 June. Check out our talk page at WT:NPR for more details. NOTE: It is extremely important that we focus on quality reviewing. Despite our goal of reducing the backlog as much as possible, please do not rush while reviewing.
Editathons
- There will be a large increase in the number of editathons in June. Please be gentle with new pages that obviously come from good faith participants, especially articles from developing economies and ones about female subjects. Consider using the 'move to draft' tool rather than bluntly tagging articles that may have potential but which cannot yet reside in mainspace.
Paid editing - new policy
- Now that ACTRIAL is ACREQ, please be sure to look for tell-tale signs of undisclosed paid editing. Contact the creator if appropriate, and submit the issue to WP:COIN if necessary. There is a new global WMF policy that requires paid editors to connect to their adverts.
Subject-specific notability guidelines
- The box at the right contains each of the subject-specific notability guidelines, please review any that are relevant BEFORE nominating an article for deletion.
- Reviewers are requested to familiarise themselves with the new version of the notability guidelines for organisations and companies.
Not English
- A common issue: Pages not in English or poor, unattributed machine translations should not reside in main space even if they are stubs. Please ensure you are familiar with WP:NPPNE. Check in Google for the language and content, tag as required, then move to draft if they do have potential.
News
- Development is underway by the WMF on upgrades to the New Pages Feed, in particular ORES features that will help to identify COPYVIOs, and more granular options for selecting articles to review.
- The next issue of The Signpost has been published. The newspaper is one of the best ways to stay up to date with news and new developments. between our newsletters.
Go here to remove your name if you wish to opt-out of future mailings. MediaWiki message delivery (talk) 20:35, 24 May 2018 (UTC)
Brewery name convention
editI'm contacting you as an active contributor on brewery articles and/or member of WikiProject Beer. There is some discussion going on as to how we should name our brewery articles. See Wikipedia_talk:WikiProject_Beer#Change_brewery_titles? and Talk:Greene_King_Brewery#Requested_move_10_May_2018. If you are interested, please comment. SilkTork (talk)
Tina Matthews
editHi Dan. I note that you created the page Tina Matthews. It needs a bit of cleaning up (not your fault) and I thought that I'd do some of this. I thought I should ping you about this so that you can take part if you'd like to. I suggest that we discuss this on the article's talk page. Ross-c (talk) 22:02, 24 May 2018 (UTC)
FLOW (American band)
editDan,
Thanks so much for jumping on the FLOW page. A point and a couple of questions:
- The group's name is FLOW, not Flow. All of their branding has FLOW. My sense is that we should stay consistent with that, right?
- I see you removed all of the links to artists that are working with FLOW, but not in Wikipedia. Is it inappropriate to have those external links? (this is the first page I've created: I've only edited pages in the past).
- I see you changed the name to Flow (American band). They're really not a "band" per se. Is there any reason why they couldn't be FLOW (American new age musical group)?
Thanks for your help!
Tom — Preceding unsigned comment added by Tjfoth (talk • contribs) 03:17, 27 May 2018 (UTC)
Your submission at Articles for creation: Kandy Post Office has been accepted
editYou are more than welcome to continue making quality contributions to Wikipedia. If your account is more than four days old and you have made at least 10 edits you can create articles yourself without posting a request. However, you may continue submitting work to Articles for Creation if you prefer.
- If you have any questions, you are welcome to ask at the help desk.
- If you would like to help us improve this process, please consider .
Thank you for helping improve Wikipedia!
Legacypac (talk) 05:31, 5 June 2018 (UTC)A barnstar for you!
editThe Writer's Barnstar | |
Kandy Post Office was very nicely done. Maybe you should be auto reviewed Legacypac (talk) 15:57, 5 June 2018 (UTC) |
I have stated reason to many moderators that the article doesn't mean to any paid promotion or anything like that. Wikipedia is a free encyclopedia where everyone can quickly get information of any of the famous personality, the article is about the world's most followed Aviation Vlogger Sam Chui he is one of the most followed Aviation Vlogger and he has lots of followers, but many of them don't know about his personal life or any detail information so wikipedia is a place where millions of people comes and visit and get information of any of the famous personality so through this article anyone can get information about Sam Chui,Regards
Vnk414 (talk) 12:15, 3 June 2018 (UTC)
- I actually agree that he is a famous blogger and am prepared to approve the page once properly sourced User:Vnk414 Legacypac (talk) 16:05, 5 June 2018 (UTC)
Orphaned non-free image File:LRB-Cool Change.jpg
editThanks for uploading File:LRB-Cool Change.jpg. The image description page currently specifies that the image is non-free and may only be used on Wikipedia under a claim of fair use. However, the image is currently not used in any articles on Wikipedia. If the image was previously in an article, please go to the article and see why it was removed. You may add it back if you think that that will be useful. However, please note that images for which a replacement could be created are not acceptable for use on Wikipedia (see our policy for non-free media).
Note that any non-free images not used in any articles will be deleted after seven days, as described in section F5 of the criteria for speedy deletion. Thank you. ShakespeareFan00 (talk) 16:15, 13 June 2018 (UTC)
Hon.
editPlease use an edit summary to indicate where there is consensus for changes like this. By the way, that edit also added df=y, yet the article text uses month first. I'll revert the edit because another problem was that it damaged the date which is causing an error to be displayed. Feel free to fix later. Johnuniq (talk) 10:08, 14 June 2018 (UTC)
Establishing Guidelines for Political Articles Conversation
editAs an active editor of Wikipedia in Sri Lankan Politics, I would like to invite you to join the discussion to establish some guidelines amongst us users.
Conversation: Wikipedia talk:WikiProject Sri Lanka# Establishing Guidelines for Political Articles Conversation
Thanks
NPP Backlog Elimination Drive
editHello Dan arndt, thank you for your work reviewing New Pages!
We can see the light at the end of the tunnel: there are currently 2900 unreviewed articles, and 4000 unreviewed redirects.
Announcing the Backlog Elimination Drive!
- As a final push, we have decided to run a backlog elimination drive from the 20th to the 30th of June.
- Reviewers who review at least 50 articles or redirects will receive a Special Edition NPP Barnstar: . Those who review 100, 250, 500, or 1000 pages will also receive tiered awards: , , , .
- Please do not be hasty, take your time and fully review each page. It is extremely important that we focus on quality reviewing.
Go here to remove your name if you wish to opt-out of future mailings. — Insertcleverphrasehere (or here) 06:57, 16 June 2018 (UTC)
Hon. instead of The Honourable
editHi Dan arndt, Could you please stop this ongoing conflict! I have given you evidence and reasons for why you should select The Honourable instead of abbreviating to Hon., and you haven't given me a reason other than the Hansard or the fact you want to keep your choice consistent. While I agree we don't have to follow the British way of doing it we also need to acknowledge the fact that is the style we use, after all we use the abbreviation MP instead of writing Member of Parliament in the suffix. Hope you understand this point and think a bit about it. It is going to take me some time as I cannot change the politicians articles of Sri Lankan politicians at once since I don' have the time, but with your assistance I hope we can do this together and keep things consistent with the rest of the world/commonwealth. - LionCountry25 (talk) 10:30, 19 June 2018 (UTC)
slow down with the trigger finger
editHey, Dan. Why not give me a chance. I started less than an hour ago. If you look at other pages on Buddhists temple, you'll see the intro rarely have references. How do you reference the existence of a PLACE!!? I will find appropriate references. I've been editing WP for about 4 years now; this is the kind off shit that makes we wants me to say f** it! JuanTamad (talk) 08:06, 30 June 2018 (UTC)
I have unreviewed a page you curated
editHi, I'm Theroadislong. I wanted to let you know that I saw the page you reviewed, User:Jankrut/sandbox, and have un-reviewed it again. If you have any questions, please ask them on my talk page. Thank you.
The Iustus Republic and micronations
editHello, I have seen the message that you have left on draft of The Iustus Republic and I would like to correct you that this page was not an attempt at being humorous or a hoax and judging by your message you did not even read the references. A micronation if you dint know is a self declared state that is not recognized by any member of The United Nations but fulfills are the requirements for state hood by The Montevideo Convention of 1933 in which the four requirements for state hood are a defined territory, a government, and a permanent population and we fulfill all of those requirements. There are in fact plenty of micronations out there and lots of them that are on wikipedia there is a whole list of them List of micronations so is there any chance of accepting it - Austin Jaax. — Preceding unsigned comment added by Austin Jaax (talk • contribs) 08:31, 4 July 2018 (UTC)
Hello!,I saw you declined the submission of this article. I understand why that happened. Here’s why I think I can prove the draft is going to be article quality. A lot of the information in the draft is from a tertiary source, MicroWiki. Micro wiki main page MicroWiki is similar to Wikipedia but focused on micronations with microwiki also having administrators that do regular checks on pages and well do there job. The Iustus Republic is a micronation, and this draft, hopefully an article in the future, is being made to show what Iustus is. Primary and secondary sources are needed for an article, and that’s what will be provided in the following weeks. Thank you and feel free to reply and we can chat about things! Sincerely, Austin Jaax. — Preceding unsigned comment added by Austin Jaax (talk • contribs) 09:24, 4 July 2018 (UTC)
E. B. Dimbulane discussion
editHi Dan and thank you for your contribution to the E. B discussion. Just a quick question, are politicians from any country notable? For example Wales has it's own politicians but none of them are what could be considered notable. Kind regards Crazy Cat Person (talk) 07:54, 9 July 2018 (UTC)
Your submission at Articles for creation: PSAV (Presentation Services Audio Visual) (July 9)
editI'm confused as to why this is not notable. -Largest AV services provider in existence. This piece of information alone makes the article noteworthy. -17000 locations of the company (like hotels it's partnered with). That's a LOT. -Owned by Goldman-Sachs. -A significantly profitable company that acquires new companies every other month.
Jack Depp article
editHi Dan, thanks for your feedback on my article on Jack Depp. I thought it was an omission and was interested when I started researching him, but accept that notability is not inherited :( Appreciate you taking the time to let me know. Many thanks, J
very late notice
edithttps://en.wikipedia.org/wiki/Wikipedia:Meetup/Perth/50 - apologies for late notice - hope you are able to make it!! JarrahTree 04:32, 14 July 2018 (UTC)
First, thank you for taking the time to review my very first submission. I just need to be enlightened on this -- if I cannot use copyrighted materials as SOURCE, it would mean using dubious sources which I think is more scary, dont you think? Please advise. Based on the review comments, I am now reading for the 2nd time, and perhaps, read it again, the content of Wikipedia:Neutral Point of View guidelines because I now see that I need to improve on the way I wrote my content. Again, thank you for the pointers.
The New York Times Non-Fiction Best Sellers of 1999 - rejection feedback
editI am trying to add to the set of Wikipedia Pages for The New York Times Non-Fiction Best Sellers by Year. Wikipedia currently has pages for 2000-2018, and a few years scattered between 1931 - 2000. I submitted a page for 1999, following the same style as the pages for years that had previously been reported and apparently approved. The reviewer denied the page saying 'Lacks significant coverage in multiple independent verifiable secondary sources'. The currently existing pages for 2000-2018 have very few references, all from the NYTimes itself and no other independent secondary source. I received this additional feedback about the post - "This submission's references do not adequately show the subject's notability". It's is unclear to me if this is referring to the content itself or just the reference material. The NYTimes best seller list is considered the preeminent list of best selling books and is used across the US as a benchmark for a book's success - it is undoubtedly notable information. How can I improve the page so that it's approved? Should the pages that exist now include more references? Thanks! Appreciate the assistance!Charmquark2 (talk) 15:42, 20 July 2018 (UTC)
- Sorry to jump into this conversation, but you might look at the response at https://en.wikipedia.org/wiki/Wikipedia:Teahouse#Article_Not_Approved_-_Appears_to_match_other_existing_articles_exactly. BeenAroundAWhile (talk) 03:43, 24 July 2018 (UTC)
Wikiproject issues
edit- @Dan arndt: Is it a general habit to avoid replying to messages there and instead post condescending messages on private talk pages? I was under the impression I didn't have to just sit there and have my contributions hand-waved away and be called 'petty' by some keyboard warrior. What was an outburst about it? I simply responded to the comments made there, and the community's arrogant, selfish outlook and your avoidance of my question on a user that was openly pushing a nationalist agenda. Did you post a message of this type on his talk page when Blackknight pretty much insulted everyone else except you?
- You can assist me by replying to messages there where everyone can see them. - ක - (talk) 04:47, 28 July 2018 (UTC)
NPR Newsletter No.12 30 July 2018
edit
|
Hello Dan arndt, thank you for your work reviewing New Pages!
- June backlog drive
Overall the June backlog drive was a success, reducing the last 3,000 or so to below 500. However, as expected, 90% of the patrolling was done by less than 10% of reviewers.
Since the drive closed, the backlog has begun to rise sharply again and is back up to nearly 1,400 already. Please help reduce this total and keep it from raising further by reviewing some articles each day.
- New technology, new rules
- New features are shortly going to be added to the Special:NewPagesFeed which include a list of drafts for review, OTRS flags for COPYVIO, and more granular filter preferences. More details can be found at this page.
- Probationary permissions: Now that PERM has been configured to allow expiry dates to all minor user rights, new NPR flag holders may sometimes be limited in the first instance to 6 months during which their work will be assessed for both quality and quantity of their reviews. This will allow admins to accord the right in borderline cases rather than make a flat out rejection.
- Current reviewers who have had the flag for longer than 6 months but have not used the permissions since they were granted will have the flag removed, but may still request to have it granted again in the future, subject to the same probationary period, if they wish to become an active reviewer.
- Editathons
- Editathons will continue through August. Please be gentle with new pages that obviously come from good faith participants, especially articles from developing economies and ones about female subjects. Consider using the 'move to draft' tool rather than bluntly tagging articles that may have potential but which cannot yet reside in mainspace.
- The Signpost
- The next issue of the monthly magazine will be out soon. The newspaper is an excellent way to stay up to date with news and new developments between our newsletters. If you have special messages to be published, or if you would like to submit an article (one about NPR perhaps?), don't hesitate to contact the editorial team here.
Go here to remove your name if you wish to opt-out of future mailings. — Insertcleverphrasehere (or here) 00:00, 30 July 2018 (UTC)
Asi Shmeltzer
edithey Dan arndt, Asi Shmeltzer is one of the most important finantial figure in israel and its international business community is it possibole to publish the article about him? — Preceding unsigned comment added by 82.81.135.66 (talk) 06:30, 30 July 2018 (UTC)
official links to G.C. Chandrashekhar
edit- Comment: As a member of parliament, G.C. Chandrashekhar satisfies WP:NPOLITICIAN however the article itself lacks inline citations to independent reliable secondary sources. The individual's website is a primary source and is not an acceptable reference. Neither are personal blogsites. If you can provide references relating to his election (i.e. government or electoral sebsites) then I would be prepared to sign this article off. Dan arndt (talk) 08:02, 30 July 2018 (UTC)
We have updated the links plz check https://en.wikipedia.org/wiki/Draft:G.C._Chandrashekhar
Review Drafts for Creation
editHi Dan arndt ! Please review my two drafts, Draft:Chotok Waterfalls and Draft:List of Pakistani Records in Guinness Book. I had submitted Draft:List of Pakistani Records in Guinness Book a week ago. Thank you.
- Nissan Oli (talk · contribs)
Request for realistic review of Draft:Additional Chief Secretary Home
editDear Dan arndt, this is with reference to your comment on this AFC i.e. according to the Department's website the current incumbent is Dr. Nirmaljit Singh Kalsi IAS which, unfortunately, is incorrect. You are, perhaps, talking of India whereas I have created the article on a Government official in Pakistan. Please note that IAS stands for Indian Administrative Service which once used to be ICS i.e. Indian Civil Service whereas PAS stands for Pakistan Administrative Service previously known as DMG or District Management Group. Please review the article, accordingly. Humble regards.JC Bills (talk) 07:09, 31 July 2018 (UTC)
Page Y Kutyur Artist
editYou did not accept Why? And what should I do? https://en.wikipedia.org/wiki/Draft:Yuri_Kutyur
Premiere galerie (talk) 08:47, 31 July 2018 (UTC)
Edits to Lynn de Silva
editHi Dan,
Thanks for your help with getting some of the full names and dates of birth/death included in the Lynn de Silva article. I was wondering where you got that information from, so that we could maybe cite it? In particular, where did you find the names of Lynn's father (John Simon de Silva), his brothers (Frederick Stanley and George Denzil), and their dates of birth, for example, 1868-1940 for John and 1904-1980 for Fred?
Many thanks, Ldesilva (talk) 09:10, 31 July 2018 (UTC)
Re-Review of Draft:Additional Chief Secretary Home
editPlease re-review my page Draft:Additional Chief Secretary Home. I have removed the biographic content from this page and added two references. The page just states as to what is the function of this official post. It comprises of: "Additional Chief Secretary (Home), previously referred to as the Home Secretary, is a senior official of BPS-22 who heads the Home Department and many other departments and attached departments concerned with Criminal justice system in the province of Punjab, Pakistan" only. As such, this page is not biography of someone for which we need to establish notability in accordance with GNG. It only describes functions of an official post in Government of Punjab, Pakistan. Foregoing in view, please consider, yet strictly on merit, if the page can be moved from draft to article space of Wikipedia. Otherwise, please guide further course of action in this regard.JC Bills (talk) 07:56, 1 August 2018 (UTC)
Howdy. It just hit me, as I was removing your three entries for the same draft at WP:Pages needing translation into English a few minutes ago, that it wasn't the first time you've posted a draft there. I just checked and this was about the tenth time you've done that. Do you monitor WP:PNT on your watchlist? It's been noted in the edit summary each time one of these entries has been removed that drafts are out of scope there. I figured I'd let you know here to save you the trouble of tagging any more of them.
WP:PNT serves the purpose of giving articles that aren't in English a two-week grace period before they're submitted for deletion. Drafts aren't in any danger of deletion on account of not being in English yet; being in another language is just another way in which a draft may not yet be suitable for article space.
Regards, Largoplazo (talk) 23:57, 1 August 2018 (UTC)
Your submission at Articles for creation: Eheliyagoda has been accepted
editThe article has been assessed as Stub-Class, which is recorded on the article's talk page. You may like to take a look at the grading scheme to see how you can improve the article.
You are more than welcome to continue making quality contributions to Wikipedia. If your account is more than four days old and you have made at least 10 edits you can create articles yourself without posting a request. However, you may continue submitting work to Articles for Creation if you prefer.
- If you have any questions, you are welcome to ask at the help desk.
- If you would like to help us improve this process, please consider .
Thank you for helping improve Wikipedia!
Theroadislong (talk) 08:59, 3 August 2018 (UTC)Articles for creation "Derek Selby"
editHello Dan sir, I submitted the page for review with name Innovations in textiles which is marked, I would appreciate if you can help me how I can correct it since I am looking its importance for WIKI FASHION project and industry people who are always keen to know what is happening new regarding innovations.I will be sincerely thankful if you can suggest a better name and delete copyright things. Thanks and regardsRajiv Sharma (talk) 09:30, 9 August 2018 (UTC)
Hello Dan, I had started this article with the belief that sources meeting the full standards of notability would not become available until after more attention was paid to the subject, seeing as he is a new author. Do you know of established pages that the draft could be merged with/added to, where there might be slightly less strict standards of notability? Lists of authors, for instance? Please give me your thoughts on this.
- RAJIVVASUDEV (talk · contribs)
Respected Sir,I got your message for rejection of Innovations in Textiles,I appreciate your observations .Looking at it's importance for Textile community who are legging behind with in technologies,few innovations must be well informed to them.Kindly suggest is there any possibility to review definitely with correct details.or I should give up and let's forget the same.
Thanks and regards
Hi Dan thank you for looking at my submission on Ghost Ship Harbor. How many references are needed to be a legitimate wikipedia article. I understand that wikipedia is not a reliable reference as you mentioned but the Boston Globe and Fodors.com I would assume is. There are many other articles and news stories that can be referenced as well. What are you suggesting? Thank you
help me its real
https://fingazeta.ru/finance/industry/449639/ http://bigrussia.org/post/read/2396 https://forklog.com/glava-kompanii-landmark-sem-chi-blokchejn-poshatnet-gegemoniyu-gollivuda-v-kinoindustrii/ http://www.vsp.ru/2018/08/07/sem-chi-hotel-by-uvidet-filmy-gde-russkie-ne-podletsy-a-geroi/ Johnhali (talk) 08:00, 14 August 2018 (UTC)
Dear Dan arndt! Thank you for reviewing my article about Klaus T. Steindl. Referring to your reason for declining: Did you really see the last version, where I made a lot of improvements (no website and IMDb, instead a lot of external sources)? But: German Wikipedia accepts IMDb as a reliable source. IMDb is very well known in film business and is used as "international film encyclopedia". Documentaries of Klaus T. Steindl are mostly international coproductions shown all around the world (USA, Australia, Russia...) - but there are only very few sources in English language, so this is an essential source to prove the international notability of this person. I am a fan of high quality documentaries, my favorite is "Wild Venice", written and directed by Klaus T. Steindl (and as I know even broadcasted in Australia). Please take a look at my german wikipedia-article about Klaus T. Steindl. There you will find a lot more infos and sources, but my english i too poor for an encyclopedia so I hope, some film-interested native speaker will improve and expend the text - but therefore it has to exist at wikipedia! So please re-review my improved article and give other persons a chance to expend it! Best regards, wofuboWofubo (talk) 14:45, 14 August 2018 (UTC)
Article for Creation "Zeng Ming"
editAzeng618 (talk) 07:38, 16 August 2018 (UTC) Good Afternoon Dan, thank you for reviewing my submission on Dr. Ming Zeng. Since your last review, I had added several new sources, including scholarly journals like JSTOR, Harvard Business Review, Forbes, and Chinese news media site, Sohu. Hope my updated information is enough to qualify Zeng as a legitimate, wikipedia worthy entry.
Thank you.
Dino Bardot Article Deletion
editHi Dan Arndt, I put citations for the fact that Dino was a member of 1990s, and sources for the fact that at least 2 of 1990s albums were made under Rough Trade Records. This makes Bardot qualify to have an article. Thanks, Bxnzedrine (talk) 07:20, 15 August 2018 (UTC)
- @Bxnzedrine: I have responded already on your talkpage. Dan arndt (talk) 07:39, 15 August 2018 (UTC)
Hi Dan Arndt, can you help me move this: https://en.wikipedia.org/wiki/Wikipedia:Dino_Bardot to an article page? It says I need an admin. Thanks, Bxnzedrine (talk) 03:26, 18 August 2018 (UTC)
hahaha
editnever thought id see you do that - they claim their oval(s) are in kenso - hahahah JarrahTree 12:14, 19 August 2018 (UTC)
- JarrahTree their ovals are actually in Como, just next to Penhros College. I’m an old boy and local resident, so I think I have a pretty good idea where they are. Dan arndt (talk) 12:58, 19 August 2018 (UTC)
- even funnier - what makes the whole thing even more absurd (wow you in good quality suburb there) is that at some point the kenso suburb was part of city of perth - it would be v interesting to have a time line/map of what city of perth had in the past - seems the changes over time have made a historical geographers dream project - lga boundaries in metro perth over the last 100 years... JarrahTree 13:01, 19 August 2018 (UTC)
- JarrahTree South Perth & Vic Park both used to be part of Perth, so it’s not so weird. Dan arndt (talk) 13:12, 19 August 2018 (UTC)
- I wouldnt use weird - I think it would be very interesting to see the periods in which the city had its tentacles over the other side of perth water and the sort of land use decisions they may or may not have influenced over time - maybe someone has done something, i dont know JarrahTree 13:15, 19 August 2018 (UTC)
- It’s just City of Perth has been broken up, reformed and broken up several times. I can vaguely remember that as part of my urban planning lectures. Round the time of the Road Boards, with both sides of the causeway falling under the same authority. Dan arndt (talk) 13:19, 19 August 2018 (UTC)
Draft:Zulkifli Abdullah
editPablomalaysia (talk) 15:09, 20 August 2018 (UTC)I have edited my draft, can you check and approve, many thanks
(AfC) Requesting review for Draft:Moideen_Koya_K._K.
editI have made all changes suggested by reviewers including you. I believe the draft is in pretty acceptable state as of now. Please review the draft and move it to the Articles section. Thank you Ubhasrk (talk) 13:00, 21 August 2018 (UTC)
- Necamswiki (talk · contribs)
I just added a citation, is it ok now?
- Necamswiki (talk · contribs)
I added citation and also I work for Mr Goldhar and we want to update the current Mitchell_Goldhar wiki with more detail content. Do I have to click publish again?
Lydia Ansel
editI appreciate you have a more qualified opinion then me on Wikapedia but on notability Lydia Ansel has got a verified twitter with a blue tick and I do know twitter don’t give verified status to any artist that’s not notable or has very little media exposure. I have added some more reliable sources as you suggestedBusinessExpert99 (talk) 07:45, 26 August 2018 (UTC)
Draft:Awillawillawillahey
editHello Dan! Thanks for the speedy review of Awillawillawillahey. I am aware of the guidelines but missed the inherit rule. Sorry about that one :) The song was very popular on radio is South America. If I can find reliable sources I will edit and resubmit it. If not I will add a delete request to the article and embed the additions to the artist page. /Thanks! WikiCoderX (talk) 13:45, 27 August 2018 (UTC)
Fractal To Desktop
editYou denied my submission because it lacked more 3rd party sources, but the software was released this afternoon. It has no other sources.
my user data was deteted
editwhy did you detected my user data and my posts. and how trailer and website for server not related to the server?
from jojocrafty — Preceding unsigned comment added by Jojocrafty (talk • contribs) 19:23, 4 September 2018 (UTC)
following a recent meeting
editWith someone with a lot of material relevant to it I would like to be able to totally re-arrange the WAMI article and do things I was hoping that Mi might be able to speak with you in some way or other I ddint want to re-arnage the whole caboodle without at least checking with you in AGF If that is not possible in the short term - it would be really good to have an idea The best way to go forward JarrahTree 12:28, 30 August 2018 (UTC)
so how to raise you for a chinwag? JarrahTree 03:20, 31 August 2018 (UTC)
ta for that JarrahTree 03:27, 31 August 2018 (UTC)
gotta find a place and time convenient - as there is quite a significant possible change in the music article and related items.... not sure which way to get your attention ... JarrahTree 07:19, 11 September 2018 (UTC)
I see this morning that my draft of Roberto Rabanne page that I spent literally 8 hours on yesterday is now GONE and deleted. Can you please put a copy of it in my sandbox so I can continue the relentless pursuit of getting it up on Wiki? I am grateful. Thank you!
Need help on Hitman Blues Band submission
editHi,
the submission was turned down because "Lacks independent verifiable sources need to establish whether it satisfies WP:NMUSICIAN. It is likely that if proof is provided establishing the band's Grammy nominations and international touring then that should be sufficient to satisfy the notability requirements."
The band was in the running for Grammy nominations, but did not get them (as stated in the article). If that should be left out, I can do that! Proof of international touring? They had multiple tours - what would be considered proof? There were plenty of articles reviewing shows, itineraries printed in numerous papers, airline ticket receipts (!) - what is needed?
There have also been many interviews in international papers, in many languages. Should they be included as proof? And why isn't the front cover of Blues In Britain not considered proof, or is it just not enough?
Also, is having a song on Rockband, albeit by a third party publisher, considered significant? There are YouTube posts that were put up of people playing it.
Finally, does having had some musicians famous in their own right (Bernard Purdie, Ray Alexander, etc.) record and perform with the band help meet the requirements?
I appreciate your time, I realize there are many criteria that must be met. I looked at the formatting and used the template to make the sidebar, but I'm not sure how that gets included in the article. It's all a bit confusing, and I'm very thankful for your assistance!
Savearainbow (talk) 21:11, 1 September 2018 (UTC)
I read your reply, but I'm at a loss as to how to provide the inline citations requested. The company that did the Rockband add-ons, Alt Strum productions, is no longer in business. But the YouTube videos are still up. The tours - should I link to online articles that reference that? Again, as far as the Grammy situation, the band had four albums that were in the running for Grammy nominations, but did not actually GET the nominations. We have no way of knowing how close it was. Should I just leave that out?
I appreciate your help, and apologize for my lack of expertise. But I want to do this right. There are a few inline citations in the article - how many are needed?
Thanks, and thanks for the quick response as well.
Savearainbow (talk) 01:56, 5 September 2018 (UTC)
Hi Dan,
I added some more references. There are live reviews, but they are published in subscription only pages online. Should I include those anyway? There are also a LOT of reviews in foreign magazines - Germany, France, Spain, etc. But they're not accessible online. Should I include them anyway? Also, how far back should I go? The band has been touring since 2004, and there are older reviews. One problem I'm having is a lot of reviews were from private websites (pre-blogs, but I guess you'd call them blogs) that no longer exist. Since blues is a niche market, there are fewer "mainstream" sites than with, say, pop. I included a Cashbox review because they've been around for over 50 years, so I'm hoping that qualifies a legitimate! Also, I included an article from the Richmond & Twickenham Times, which is published in both hard copy and online. They've been around since 1873, so that's pretty legit!
Finally, I don't know if this is worth adding. Scott Ian (Anthrax) mentions Russell Alexander in his autobiography, as Hitman was his first (and only) guitar teacher. If you think it's worth putting in as just an interesting bit, I can find out the page number and ISBN and all that stuff. It's a really nice few paragraphs, very complimentary.
Thanks again for your help.
Savearainbow (talk) 18:58, 8 September 2018 (UTC)
Grrrr - I'm having trouble because so many of their reviews, going back to 2000, are either not online anymore (although the sites are still there) or you have to have a subscription. For example, they got great reviews of their last release in Germany, France, Poland, Italy, and Spain - but they're not online, and the publicist gave them copies of the articles without the page numbers and dates of publication. So they're useless! And there are live reviews, but many are on blogs (which aren't valid but prevalent in the blues community). I'm going to add one more site - La Hora Del Blues - which has been around forever and reviews every blues artist you can think of. Should I resubmit after that or is it still not enough?
As always, thanks for the guidance!
Hulftsdorp
editHi, Hulftsdorp is the official name for this suburb in Colombo. Please move this page to Hulftsdorp. Thank you.--Kanags (talk) 11:29, 11 September 2018 (UTC)
- Dan arndt, thank you for the move. But the history is lost.--Kanags (talk) 11:51, 12 September 2018 (UTC)
Tihon Chernyaev
editHi, I'm trying to fix Draft:Tihon_Chernyaev and I have questions about sources. Asking you since you were the one who declined the submission.
- Can I use sources in a foreign language? Specifically an article in BBC Ukraine and a video of TV coverage from TV Channel Ukraine
- I included links to 2 videos from "ChessNetwork" who is the largest chess-themed YouTube channel by subscribers. Don't know if it qualifies as an appropriate source.
- Let me know if there are other concerns with the draft. Thank you
- Zsoltnyiri (talk · contribs)
Dear Dan, thank you for supporting Wikipedia and volunteering to help. This is my very first time that I attempt to enter information on Wikipedia. I am not familiar with the protocols and policies as well as the technology to create articles. Hence, my mistakes you observe need attention and some specified guidance by you to rectify my errors. Would you be able and be the right person to rewrite the article as to meet the Wikipedia criteria?
All historical and factual data are embedded in the website itself to which I provided the links. It includes company registration number, physical office addresses, contact details as to provide proof of existence of the companies in their respective 'About Us' section. There are already articles about the Institute for Strategy and Complexity Management (ISCM), notably we presented at the ISSS 2011 our research results on why projects fail: http://isss.org/conferences/hull2011/2011_Program_Book.pdf and search in the file for Institute for Strategy and Complexity Management (ISCM, viewpointmodel). What is intended with the Wikipedia entry is to provide a reference to the work of the ISCM and how it evolved to put theory of Systems Thinking into practice. In our case to deal with job creation and societal well-being on the African continent. The challenge is huge and very complex. I wish to portray objectively the evolution of how a research organisation in strategic scenario planning, using state of the art computer modelling, wishes to contribute to good governance as to secure project implementation success. The ultimate goal is to document how we provide investors with mathematical tools insights to the driving forces that lead to implementation success - securing their funding for sustainable development on the African continent. Africa suffers from a lack of leadership excellence in terms of interpretation by western cultures. Such lack of required leadership excellence reinforces the cause of financial losses and the increased evidence of bribery and corruption. Nevertheless, it opens further hesitation by serious investors to place funding in Africa. This is a topic we wish to be dealt with by writing about our structure as to combat these influence factors. But also to put emphasis on recognising on all attempts of help from outside has failed dismally on Africa. Our work consists of presenting solutions listening to African viewpoints of self-determination, thereby identifying the driving forces for the investment and implementation success.
ISCM and its governance companies are not in the foreground but playing a significant role in guiding and routing the investments through its structure. Hence, the additional emphasis on the custodian's roles and the cooperation of an independent integrity platform during project execution. In the Wikipedia, we wish to have noted that ISCM is using such practises as to secure investor confidence. We observed that large politically biased organisations or initiatives have failed Africa by holding on socio-economic results only - neglecting cultural transformative aspects to the detriment of next generation development opportunities and have no tools to register such information in their planning.
I may have caused the wrong impression in my proposed Wikipedia content and hope the above context will rectify some of your observations, hence; you and other Wikipedia experienced authors could assist our charity and volunteer-based non-profit organisations to be noted in Wikipedia with an acceptable content and format.
Your support and comments are highly appreciated.
Warmest regards from the Netherlands, Zsolt Nyiri, chair ISCM Foundation Zsoltnyiri (talk) 09:13, 16 September 2018 (UTC)
Page move
editHi, and thank you for your contributions to Wikipedia. It appears that you tried to give Hultsdorp a different title by copying its content and pasting either the same content, or an edited version of it, into Hulftsdorp. This is known as a "cut-and-paste move", and it is undesirable because it splits the page history, which is legally required for attribution. Instead, the software used by Wikipedia has a feature that allows pages to be moved to a new title together with their edit history.
In most cases, once your account is four days old and has ten edits, you should be able to move an article yourself using the "Move" tab at the top of the page (the tab may be hidden in a dropdown menu for you). This both preserves the page history intact and automatically creates a redirect from the old title to the new. If you cannot perform a particular page move yourself this way (e.g. because a page already exists at the target title), please follow the instructions at requested moves to have it moved by someone else. Also, if there are any other pages that you moved by copying and pasting, even if it was a long time ago, please list them at Wikipedia:Requests for history merge. Thank you. Obi2canibe (talk) 16:17, 16 September 2018 (UTC)
NPR Newsletter No.13 18 September 2018
editHello Dan arndt, thank you for your work reviewing New Pages!
The New Page Feed currently has 2700 unreviewed articles, up from just 500 at the start of July. For a while we were falling behind by an average of about 40 articles per day, but we have stabilised more recently. Please review some articles from the back of the queue if you can (Sort by: 'Oldest' at Special:NewPagesFeed), as we are very close to having articles older than one month.
- Project news
- The New Page Feed now has a new "Articles for Creation" option which will show drafts instead of articles in the feed, this shouldn't impact NPP activities and is part of the WMF's AfC Improvement Project.
- As part of this project, the feed will have some larger updates to functionality next month. Specifically, ORES predictions will be built in, which will automatically flag articles for potential issues such as vandalism or spam. Copyright violation detection will also be added to the new page feed. See the projects's talk page for more info.
- There are a number of coordination tasks for New Page Patrol that could use some help from experienced reviewers. See Wikipedia:New pages patrol/Coordination#Coordinator tasks for more info to see if you can help out.
- Other
- A new summary page of reliable sources has been created; Wikipedia:Identifying reliable sources/Perennial sources, which summarizes existing RfCs or RSN discussions about regularly used sources.
- Moving to Draft and Page Mover
- Some unsuitable new articles can be best reviewed by moving them to the draft space, but reviewers need to do this carefully and sparingly. It is most useful for topics that look like they might have promise, but where the article as written would be unlikely to survive AfD. If the article can be easily fixed, or if the only issue is a lack of sourcing that is easily accessible, tagging or adding sources yourself is preferable. If sources do not appear to be available and the topic does not appear to be notable, tagging for deletion is preferable (PROD/AfD/CSD as appropriate). See additional guidance at WP:DRAFTIFY.
- If the user moves the draft back to mainspace, or recreates it in mainspace, please do not re-draftify the article (although swapping it to maintain the page history may be advisable in the case of copy-paste moves). AfC is optional except for editors with a clear conflict of interest.
- Articles that have been created in contravention of our paid-editing-requirements or written from a blatant NPOV perspective, or by authors with a clear COI might also be draftified at discretion.
- The best tool for draftification is User:Evad37/MoveToDraft.js(info). Kindly adapt the text in the dialogue-pop-up as necessary (the default can also be changed like this). Note that if you do not have the Page Mover userright, the redirect from main will be automatically tagged as CSD R2, but in some cases it might be better to make this a redirect to a different page instead.
- The Page Mover userright can be useful for New Page Reviewers; occasionally page swapping is needed during NPR activities, and it helps avoid excessive R2 nominations which must be processed by admins. Note that the Page Mover userright has higher requirements than the NPR userright, and is generally given to users active at Requested Moves. Only reviewers who are very experienced and are also very active reviewers are likely to be granted it solely for NPP activities.
List of other useful scripts for New Page Reviewing
|
---|
|
Go here to remove your name if you wish to opt-out of future mailings. MediaWiki message delivery (talk) 23:11, 17 September 2018 (UTC)
Draft:Princeton Hsu (1900-1999) still in review?
editAre you still reviewing Draft:Princeton Hsu (1900-1999)? I haven't seen much improvement to make it ready to move from draft. AngusWOOF (bark • sniff) 21:16, 18 September 2018 (UTC)
Writer Shaunak Chakraborty
editYou recently declined my article Writer Shaunak Chakraborty can you suggest me that what should I do so that my article will select for sure next time. Rupiah968 (talk) 12:13, 26 September 2018 (UTC)
Translation of drafts again
editHi, did you see the note I left here on August 1 about pages in Draft space that aren't in English? I drew your attention to the fact that drafts are out of scope at WP:Pages needing translation and that the {{Not English}} tag is therefore inapplicable to them. I just removed your latest entry, Draft:Selebriti Anti Narkoba Indonesia, from WP:PNT, and removed the {{Not English}} tag from that page. Largoplazo (talk) 15:56, 27 September 2018 (UTC)
- OH! I just noticed that you only tagged the article, and that it was the creator, Mfadelchristopol, who went and added the request to WP:PNT later. Largoplazo (talk) 16:58, 27 September 2018 (UTC)
A brownie for you!
editHello, enjoy a brownie! Wcampbell1144 (talk) 18:05, 28 September 2018 (UTC) |
I am trying to figure out what I'm missing in the article (my first) I'm writing about Terence Smith, a footballer with the USL Tulsa Roughnecks.
The comments left after the article was declined indicate:
1) Terence is not notable. Yet on the same page I see info that players for professional sports teams are automatically considered notable. Mr. Smith does appear on the published roster for the team in question. I will be including a link in his page that goes directly back to the roster for clarity. I'm not sure how else to show that he is currently playing, other than to show the team's press release stating they signed him, and their current roster showing him as an active player. Do you have a suggestion for me?
2) The references are not in the form of footnotes. I have use the "Cite" button on the toolbar, then pasted the URL of the published news story that was my source. Does this not auto-generate a footnote? Can you please help, I don't know what step I'm missing. I'm going to try manually editing the notes to make the footnote appear slightly differently, in hopes that this meets your approval.
Thank you, Darren D.pelau (talk) 01:36, 2 October 2018 (UTC)
KLASK article
editDear Dan,
Thank you for giving me feedback on my KLASK article (https://en.wikipedia.org/wiki/Draft:KLASK). I have now edited it a lot since you first commented on it and would like to hear if there is more that should be corrected before it is publishable?
Thank you for your time. — Preceding unsigned comment added by 2001:14BA:8F6:9600:FDCB:1DB4:F444:434F (talk) 09:09, 2 October 2018 (UTC)
Hospital
editHello Dan. Since you appear to be the one who tagged the Draft space copy, I also noticed User:Aziz Fatimah Hospital/sandbox. This version appears to have been expanded although I can still find matching text from the website, especially in the lead, I'm not sure if it's blatant enough for CSD so I didn't do it yet. This is also clearly a COI situation... —PaleoNeonate – 16:51, 3 October 2018 (UTC)
Request for Review
editHi, Dan! Thank you for the point you made in my article. I revised my article https://en.wikipedia.org/wiki/Draft:Edukasyon.ph and made sure all are properly cited. But I haven't received any feedback from you. Hope you can find time to review my article and let me know if I miss anything. Thanks so much in advance! — Preceding unsigned comment added by 3dukasyon (talk • contribs) 07:12, 5 October 2018 (UTC)
Vishnukvv (talk) 09:02, 5 October 2018 (UTC)
Hello,
there is a website for this temple created ... srinagavallilakshminarasimhaswamy.com is that suffiecient for you to approval? if so please approve otherwise you can remove the article.
Draft: Ahmad Bakhshi
edithi Dan about Draft:Ahmad Bakhshi This person is one of the well-known people in Iranian cinema.The Persian Wikipedia has a detailed page about him, With a lot of precise resources! Since we need an English translation of his biography, I summarize with regard to the Persian page and sources such as the IMDB and other resources of Iranian movies database. All these sources are authentic and accepted by wikipedia in persian ( [1] ) Please guide us because we really need a biography in English about this person! thanks a lot — Preceding unsigned comment added by Abelucas (talk • contribs) 13:58, 5 October 2018 (UTC)
Hi Dan, thank you for a quick review and reply. From what I'm reading, the references I included were not "secondary" sources not independent of Jay Jones. I've added 2 more that I'm hoping would suffice. As you will see, one is an article from the South Florida Times newspaper specifically about Jay Jones, and the other is another mention from Lil Wayne/Young Money's website which is the official record label. If you look into the content you will see that he is officially with Young Money and a Lil Wayne artist. Hopefully this helps. If not, is it more of a "notoriety" issue? Thanks Dan.
Brad Robinson
editIn line with most music bios, should we move the Armstrong marriage/divorce and his disease/death into a separate section, e.g. Personal life?shaidar cuebiyar (talk) 21:10, 8 October 2018 (UTC)
General Question
editAs you said in article on (DJ Kamal Mustafa) that imdb isn't accepted but have you checked other links which i mentioned ? Such as mtv chart , new york times , urdu point newspaper , awaz.tv & etc link aren't they notable ? Also it has two interview in magazine (amb & other). But I'm also adding two more references kindly check it.
Pak-MI (talk) 08:06, 9 October 2018 (UTC)
Draft:sanjay chhimpa Why this draft was removed while all things were streamlined
Draft
editHi, Thank you for accepting my previous draft, I have another: https://en.wikipedia.org/wiki/Draft:Monopterus_rongsaw, but I can't submit it to AfC. Can you review this?
Thanks --Boothsift (talk) 06:19, 16 October 2018 (UTC)
Draft Pierre Jovanovic
editHello Dan. I have done a serious upgrade to the page Pierre Jovanovic https://en.wikipedia.org/wiki/Draft:Pierre_Jovanovic I added many citations and footnotes. Could you please review this new submission ? Thanks. Micha Jo (talk) —Preceding undated comment added 01:12, 17 October 2018 (UTC)
It is now already 38 days old. Waiting such a long time for feedback is disheartening ... I am not sure that I will author anything again. Regards. Micha Jo (talk) 13:31, 17 October 2018 (UTC)
Eight summits page deletion
editHi, thank you for your message. However, I don’t agree that the page should be merged to the “seven submits”, in fact, on the page of “seven summits”, you will notice that eight mountains are listed out.
Thanks, Jackie1128 Jackie1128 (talk) 17:25, 17 October 2018 (UTC)
My Draft : Nakul Abhyankar
editHello,
Thank you for your comments. It has been a month since you left your review. Since then I have added third party references and sources to increase the credibility of the article and establish that the subject of the article has done notable work in the field of music . Please re-review it. Thanks again for your time. Appreciate your work. You are doing a great job. BhargavaAnirudh7 (talk) 01:42, 18 October 2018 (UTC)
Additional Sources
editHi, I would like to thank you first for accepting two of my drafts. As with your request to add more sources, I have found nothing else(none that provide any info). Even the Encyclopedia of Life and IUCN do not have a entry on it. The species is poorly documented.
Thank you--Boothsift (talk) 05:02, 19 October 2018 (UTC)
Hello! I am really dispappointed because my wiki page proposal was rejected (https://en.wikipedia.org/wiki/Draft:2020_Design). I don't understand because almost of the software developers own a wiki page.
https://en.wikipedia.org/wiki/Sweet_Home_3D https://en.wikipedia.org/wiki/SmartDraw https://en.wikipedia.org/wiki/SketchUp
Why not us? What I have to do?
Thank you for your support.
Supermartin2020 (talk) 16:06, 17 October 2018 (UTC)
- hi we have absolutely same problem, it is like wikipedia refusing to publish game titles without strong marketing and or paid reviews elsewhere. we have thousands of downloads daily, people just using app, they rate and review on appstore and from my point of view everything above mentioned is waste of time for the users, thats why we did not create fb,tw,in,xy,yz social pages...
- wiki building world standard that you must be 'social' and build all the nonsense promo and marketing around. this all keeping big companies at the top and smaller studios are disadvantaged. a little example is google and their services, app with wiki record will be at higher than without, it is under a spell loop. — Preceding unsigned comment added by Mouseforcats (talk • contribs) 09:15, 19 October 2018 (UTC)
i know that if you rejecting pages every few minutes that it is rutine for you, but try to imagine you are new user here. please specify which informations you need to verify! It is very frustrating if you got some text and somebody tell you i need to verify something from the text. Should we guess what you want to verify? Or try step by step every word from text? — Preceding unsigned comment added by Mouseforcats (talk • contribs) 09:30, 19 October 2018 (UTC)
Hi Dan
editYou rejected my article on Rustom Palia because it was a report of a single event. That seems fair enough. However, since you're an Aussie, I'd like to bring up an interesting counterexample. The Joe the Cameraman article was deemed to be noteworthy enough even though he was famous for a single incident involving the cricketer Shane Warne. How can one explain this apparent discrepancy? — Preceding unsigned comment added by Srwadia (talk • contribs) 12:46, 20 October 2018 (UTC)
Draft Pierre Jovanovic, Adresses your concerns and improved the page
editHello Dan. Thanks for your input. I took your concerns into account and improved the page. It is much better now than at the beginning, and I believe that it now passes the criteria for publication. Could you please review it again ? Regards. Micha Jo (talk) 05:18, 21 October 2018 (UTC)
NPR Newsletter No.14 21 October 2018
edit
|
Hello Dan arndt, thank you for your work reviewing New Pages!
- Backlog
As of 21 October 2018[update], there are 3650 unreviewed articles and the backlog now stretches back 51 days.
- Community Wishlist Proposal
- There is currently an ongoing discussion regarding the drafting of a Community Wishlist Proposal for the purpose of requesting bug fixes and missing/useful features to be added to the New Page Feed and Curation Toolbar.
- Please join the conversation as we only have until 29 October to draft this proposal!
- Project updates
- ORES predictions are now built-in to the feed. These automatically predict the class of an article as well as whether it may be spam, vandalism, or an attack page, and can be filtered by these criteria now allowing reviewers to better target articles that they prefer to review.
- There are now tools being tested to automatically detect copyright violations in the feed. This detector may not be accurate all the time, though, so it shouldn't be relied on 100% and will only start working on new revisions to pages, not older pages in the backlog.
- New scripts
- User:Enterprisey/cv-revdel.js(info) — A new script created for quickly placing {{copyvio-revdel}} on a page.
Go here to remove your name if you wish to opt-out of future mailings. — Insertcleverphrasehere (or here) 20:49, 21 October 2018 (UTC)
Sarah Scantlin
editYour rejection is not helpful or wise. Sarah Scantlin is the most remarkable, known case of this medical condition. She is not notable because she died. It is not a memorial page. She is notable because she is one of a kind in the world. I was disappointed that i could not find an article about her in wikipedia. So I made one. I don't know who made you wiki-king or why you would reject this amazing, one-of-a-kind medical phenomena Cap263 (talk) 05:46, 26 October 2018 (UTC)
Stop Fake In Kashmir
editSir I created the draft about Stop Fake In Kashmir but you deleted the draft. I am new to wikipedia. How I can recover that Kashmirwikihub (talk) 04:47, 20 October 2018 (UTC)
- He's not new, he's the 9th sockpuppet of Kashmirwindow. Cabayi (talk) 10:28, 27 October 2018 (UTC)
Your advice taken into account. Thanks for your help. Could you please review again ?
editHello Dan. Following your advice I improved the page on Draft:Pierre Jovanovic. I did serious cleaning of sources. I also read closely the instructions on BLP (Biography of Living Persons) and checked for compliance. It seems to me that all is OK now. Could you please have another look ? Thanks for your help. Micha Jo (talk) 08:36, 31 October 2018 (UTC)
NPR Newsletter No.15 16 November 2018
edit
Chart of the New Pages Patrol backlog for the past 6 months. |
Hello Dan arndt,
- Community Wishlist Survey – NPP needs you – Vote NOW
- Community Wishlist Voting takes place 16 to 30 November for the Page Curation and New Pages Feed improvements, and other software requests. The NPP community is hoping for a good turnout in support of the requests to Santa for the tools we need. This is very important as we have been asking the Foundation for these upgrades for 4 years.
- If this proposal does not make it into the top ten, it is likely that the tools will be given no support at all for the foreseeable future. So please put in a vote today.
- We are counting on significant support not only from our own ranks, but from everyone who is concerned with maintaining a Wikipedia that is free of vandalism, promotion, flagrant financial exploitation and other pollution.
- With all 650 reviewers voting for these urgently needed improvements, our requests would be unlikely to fail. See also The Signpost Special report: 'NPP: This could be heaven or this could be hell for new users – and for the reviewers', and if you are not sure what the wish list is all about, take a sneak peek at an article in this month's upcoming issue of The Signpost which unfortunately due to staff holidays and an impending US holiday will probably not be published until after voting has closed.
Go here to remove your name if you wish to opt-out of future mailings. — Insertcleverphrasehere (or here)18:37, 16 November 2018 (UTC)
ArbCom 2018 election voter message
editHello, Dan arndt. Voting in the 2018 Arbitration Committee elections is now open until 23.59 on Sunday, 3 December. All users who registered an account before Sunday, 28 October 2018, made at least 150 mainspace edits before Thursday, 1 November 2018 and are not currently blocked are eligible to vote. Users with alternate accounts may only vote once.
The Arbitration Committee is the panel of editors responsible for conducting the Wikipedia arbitration process. It has the authority to impose binding solutions to disputes between editors, primarily for serious conduct disputes the community has been unable to resolve. This includes the authority to impose site bans, topic bans, editing restrictions, and other measures needed to maintain our editing environment. The arbitration policy describes the Committee's roles and responsibilities in greater detail.
If you wish to participate in the 2018 election, please review the candidates and submit your choices on the voting page. MediaWiki message delivery (talk) 18:42, 19 November 2018 (UTC)
ArbCom 2018 election voter message
editHello, Dan arndt. Voting in the 2018 Arbitration Committee elections is now open until 23.59 on Sunday, 3 December. All users who registered an account before Sunday, 28 October 2018, made at least 150 mainspace edits before Thursday, 1 November 2018 and are not currently blocked are eligible to vote. Users with alternate accounts may only vote once.
The Arbitration Committee is the panel of editors responsible for conducting the Wikipedia arbitration process. It has the authority to impose binding solutions to disputes between editors, primarily for serious conduct disputes the community has been unable to resolve. This includes the authority to impose site bans, topic bans, editing restrictions, and other measures needed to maintain our editing environment. The arbitration policy describes the Committee's roles and responsibilities in greater detail.
If you wish to participate in the 2018 election, please review the candidates and submit your choices on the voting page. MediaWiki message delivery (talk) 18:42, 19 November 2018 (UTC)
I'm a person who work for official "CONFERNCE ON TOURISM DEVELOPMENT COOPERATION LINKING THE WORLD HERITATE IN THREE PROVINCES OF UDON THANI * LUANG PRABANG * QUANG NINH" And I have to complete my work by publishing the information about this project as I has published on 19 November 2018 and It was declined. However, I still have to publish this, it necessary for this governmental conference. So, can anyone tell me how I can fix this issue. Thank you.
My Draft:Finnish_Air_Force_sighting has been resubmitted. It was also edited by KylieTastic and is waiting for re-review. It should pass now.
Orphaned non-free image File:Ivy League Records.jpg
editThanks for uploading File:Ivy League Records.jpg. The image description page currently specifies that the image is non-free and may only be used on Wikipedia under a claim of fair use. However, the image is currently not used in any articles on Wikipedia. If the image was previously in an article, please go to the article and see why it was removed. You may add it back if you think that that will be useful. However, please note that images for which a replacement could be created are not acceptable for use on Wikipedia (see our policy for non-free media).
Note that any non-free images not used in any articles will be deleted after seven days, as described in section F5 of the criteria for speedy deletion. Thank you. --B-bot (talk) 03:33, 28 November 2018 (UTC)
Orphaned non-free image File:Sp-disco king.jpg
editThanks for uploading File:Sp-disco king.jpg. The image description page currently specifies that the image is non-free and may only be used on Wikipedia under a claim of fair use. However, the image is currently not used in any articles on Wikipedia. If the image was previously in an article, please go to the article and see why it was removed. You may add it back if you think that that will be useful. However, please note that images for which a replacement could be created are not acceptable for use on Wikipedia (see our policy for non-free media).
Note that any non-free images not used in any articles will be deleted after seven days, as described in section F5 of the criteria for speedy deletion. Thank you. --B-bot (talk) 03:49, 9 December 2018 (UTC)
Sri Lanka Rugby Championship
editHi Dan, while tweaking the table formats I inadvertently changed the name of the final column on the Former Division A table from seasons to titles - as you probably noticed. Should I change it back? - I think I probably should -- Ham105 (talk) 08:03, 12 December 2018 (UTC)
NPR Newsletter No.16 15 December 2018
editHello Dan arndt,
- Reviewer of the Year
This year's award for the Reviewer of the Year goes to Onel5969. Around on Wikipedia since 2011, their staggering number of 26,554 reviews over the past twelve months makes them, together with an additional total of 275,285 edits, one of Wikipedia's most prolific users.
- Thanks are also extended for their work to JTtheOG (15,059 reviews), Boleyn (12,760 reviews), Cwmhiraeth (9,001 reviews), Semmendinger (8,440 reviews), PRehse (8,092 reviews), Arthistorian1977 (5,306 reviews), Abishe (4,153 reviews), Barkeep49 (4,016 reviews), and Elmidae (3,615 reviews).
Cwmhiraeth, Semmendinger, Barkeep49, and Elmidae have been New Page Reviewers for less than a year — Barkeep49 for only seven months, while Boleyn, with an edit count of 250,000 since she joined Wikipedia in 2008, has been a bastion of New Page Patrol for many years.
See also the list of top 100 reviewers.
- Less good news, and an appeal for some help
The backlog is now approaching 5,000, and still rising. There are around 640 holders of the NPR flag, most of whom appear to be inactive. The 10% of the reviewers who do 90% of the work could do with some support especially as some of them are now taking a well deserved break.
- Really good news - NPR wins the Community Wishlist Survey 2019
At #1 position, the Community Wishlist poll closed on 3 December with a resounding success for NPP, reminding the WMF and the volunteer communities just how critical NPP is to maintaining a clean encyclopedia and the need for improved tools to do it. A big 'thank you' to everyone who supported the NPP proposals. See the results.
- Training video
Due to a number of changes having been made to the feed since this three-minute video was created, we have been asked by the WMF for feedback on the video with a view to getting it brought up to date to reflect the new features of the system. Please leave your comments here, particularly mentioning how helpful you find it for new reviewers.
If you wish to opt-out of future mailings, go here.
MediaWiki message delivery (talk) 21:14, 14 December 2018 (UTC)
New Project
editHi Dan, how are you? Really glad to see that you're still working on the Sri Lankan political biographies. All the work you have done is amazing, thank you for your hard work! I have another project I thought you might be interested in! I've been creating the biographies of all the Justices of the Supreme Court of Sri Lanka since its inception, and been organising the Judiciary of Sri Lanka here on Wiki (pretty much creating the whole thing). You don't have to but your welcome to help, its an interesting project so I thought it might grab your attention. I've already organised much of it to make work easier.
Also this: Electoral districts of Sri Lanka (1947–1989) might help you for work on the politicians. Looking forward to hearing from you.--Blackknight12 (talk) 02:31, 15 December 2018 (UTC)
Orphaned non-free image File:Downsyde clap.jpg
editThanks for uploading File:Downsyde clap.jpg. The image description page currently specifies that the image is non-free and may only be used on Wikipedia under a claim of fair use. However, the image is currently not used in any articles on Wikipedia. If the image was previously in an article, please go to the article and see why it was removed. You may add it back if you think that that will be useful. However, please note that images for which a replacement could be created are not acceptable for use on Wikipedia (see our policy for non-free media).
Note that any non-free images not used in any articles will be deleted after seven days, as described in section F5 of the criteria for speedy deletion. Thank you. --B-bot (talk) 18:28, 15 December 2018 (UTC)
i have submitted an article on the topic Sibi Mela, it was not approved. The contents are not copied from any other source. The references are given from Books, page number and links are given in reference section. How it should be approved if resubmit again. There is no copied text in it.
Could you remove the speedy-deletion tag from the draft ? The draft does suffer from close paraphrasing but is not a complete c/p of the source you mentioned. G-12 should only be used when there is no salvageable material in the page. Regards. — fr ❄ 05:20, 27 December 2018 (UTC)
Thanks! Crikey, where did you find all that? Quite some library you have there; I started the article in response to a newspaper arts editor friend who was playing her old records, and I remembered the "Private Lives" single, and wondered "oh, what does Wikipedia say about them?" It would be good if the community accepted your changes, and the article as a whole. JW User:John_Warburton —Preceding undated comment added 12:03, 31 December 2018 (UTC)
Rejecting drafts
editHi! You are leaving notices with undefined reject reason on new users' talk page. Please specify reasons when rejecting drafts, or else you may confuse them. Thanks. ―Abelmoschus Esculentus talk / contribs 07:55, 3 January 2019 (UTC)
Hi Im unsure of how to make a post but mine was declined and im unsure of why. Can anyone assist please, I dont have a back up of teh original page to delete the material that caused it to be declined. Draft - Secret society of super villain artists By Rotaholder
Disambiguation link notification for January 7
editHi. Thank you for your recent edits. An automated process has detected that when you recently edited Currency museum, Colombo, you added a link pointing to the disambiguation page Atrium (check to confirm | fix with Dab solver). Such links are usually incorrect, since a disambiguation page is merely a list of unrelated topics with similar titles. (Read the FAQ • Join us at the DPL WikiProject.)
It's OK to remove this message. Also, to stop receiving these messages, follow these opt-out instructions. Thanks, DPL bot (talk) 09:18, 7 January 2019 (UTC)
Draft:Edaphobacter aggregans to Edaphobacter aggregans
editHello! Thank you for helping me with my most recent article. While looking at the history for this article I noticed that you made the following edit: Draft:Edaphobacter aggregans to Edaphobacter aggregans. I was wondering how you did this so that I can do it in the future. Thank you for your contributions to Wikipedia. Coralizzie1 (talk) 02:59, 8 January 2019 (UTC) Coralizzie1
After reading your last comment is the only way to link the scientific classification and taxon identifiers to a new page is by being a reviewer? Thank you for helping clear up this confusion. Coralizzie1 (talk) 03:11, 8 January 2019 (UTC)
Yes I am talking about something that happened when you edited the draft. When it was edited more information was added, such as the scientific classification box on the side and the taxon identifiers box on the bottom. I was wondering how these edits were made so that I can make them in the future. Coralizzie1 (talk) 03:28, 8 January 2019 (UTC)
Thank you for your help, I now have a better understanding on how to add that information to an article. Coralizzie1 (talk) 03:38, 8 January 2019 (UTC)
Cama Gallery
editThis article was rejected according to lacks of any sources or references. Therefore I have added references and improved it all. Editorialbmt123 (talk) 12:16, 9 January 2019 (UTC)
Minaret Kabir
editHello Dan, Thank you for working on my article Minaret Kabir and taking it our of draft. Actually I spent a lot of time but could not find new sources for this article . may be you can teach me how you found these sources. thank you again Alex-h (talk) 10:20, 10 January 2019 (UTC)
Draft
editHello Dan arndt and sorry to bother you again. I have another article which has been in draft for two months , Draft:Baskut Tuncak , I wonder if you could check that one as well.I appreciate that. Alex-h (talk) 13:12, 12 January 2019 (UTC)
Thanks
editDraft:Treeffers - Was getting back to this but went off to answer some talk page requests on a Wikiproject first. Thanks for taking care of it. --CNMall41 (talk) 04:33, 21 January 2019 (UTC)
Your submission at Articles for creation: Syawa, India has been accepted
editThe article has been assessed as Stub-Class, which is recorded on the article's talk page. You may like to take a look at the grading scheme to see how you can improve the article.
You are more than welcome to continue making quality contributions to Wikipedia. If your account is more than four days old and you have made at least 10 edits you can create articles yourself without posting a request. However, you may continue submitting work to Articles for Creation if you prefer.
- If you have any questions, you are welcome to ask at the help desk.
- If you would like to help us improve this ++process, please consider .
Thank you for helping improve Wikipedia!
Dan arndt (talk) 02:57, 25 January 2019 (UTC)Draft: The Chalybeate Spring at Mittagong, NSW
editHi Dan, I notice that you have moved my draft 'The Chalybeate Spring at Mittagong NSW' to 'Chalybeate Springs, New South Wales' and I understand that you are trying to meet some naming conventions. There is a problem with the new name. The article is not about all the 'chalybeate springs' - a generic term as in the Wikipedia article Chalybeate - in New South Wales, but just one spring that was called 'The Chalybeate Spring' at Mittagong, NSW. So, in meeting the naming convention the new name no longer conveys what is being described in the article. Can you have a think about this and reconsider the name and try to find something closer to what the article is about. Happy to try and meet conventions - that's a good thing - but still need a title that fits the content.
Thanks, --TrimmerinWiki (talk) 02:14, 26 January 2019 (UTC)
Hi Dan, Thank you for the suggestion that 'Chalybeate Spring, New South Wales' i.e. the singular form could be a suitable title. I understand fully why you want to enforce the convention and would be more than happy with the singular-form title (in the absence of other articles on other chalybeate springs in New South Wales). Much appreciated. Thanks, --TrimmerinWiki (talk) 04:51, 26 January 2019 (UTC)
Your submission at Articles for creation: Royal Suva Yacht Club has been accepted
editThe article has been assessed as C-Class, which is recorded on the article's talk page. You may like to take a look at the grading scheme to see how you can improve the article.
You are more than welcome to continue making quality contributions to Wikipedia. If your account is more than four days old and you have made at least 10 edits you can create articles yourself without posting a request. However, you may continue submitting work to Articles for Creation if you prefer.
- If you have any questions, you are welcome to ask at the help desk.
- If you would like to help us improve this process, please consider .
Thank you for helping improve Wikipedia!
Legacypac (talk) 13:23, 26 January 2019 (UTC)
- Deejames007 (talk · contribs)
Parmish Verma Draft
editHello Dan, I have just created a draft of Parmish Verma. I added a lot of information about him with proper citations. Please review them and accept the submission if all is right. Please let me know in case of any concern. Thanks Iamharjeet (talk) 20:55, 27 January 2019 (UTC) iamharjeet
Thank you Dan for help with Georgiana Uhlyarik AGO Curator Page
editHello Dan, thank you for your help and suggestions. I have added in-line citations and resubmitted ... much obliged for your continued inputMecla (talk) 17:56, 27 January 2019 (UTC)
Hey Dan, I was wondering if someone could cite the sources for me because I don't know how — Preceding unsigned comment added by 2600:6C51:747F:D58A:A85A:2E4B:C3E5:1AEA (talk) 00:17, 28 January 2019 (UTC)
"Draft: Mainak Misra" Page
editDear Dan,
Greetings for the day !!
Today you have added 'Maintenance Template' on the above mentioned draft. Could you please help me to edit this article if required. I have provided all the neutral sources for this page. Please let me know if you need any clarification. Thanks much. Manishachatterjee96 (talk) 05:31, 28 January 2019 (UTC)
Draft:Ibrahim Hasan Murad
editDear Dan, I'm new to Wikipedia, I disclosed in accordance with the Wikimedia Foundation's Terms of Use, but my article still got declined by you. Kindly help me out here that what is needed more and what am I missing there in the draft of my article on the subject.
RegardsMiqazi (talk) 07:35, 28 January 2019 (UTC)
Your submission at Articles for creation: DildoLanka (January 30)
edit- If you would like to continue working on the submission, go to Draft:DildoLanka and click on the "Edit" tab at the top of the window.
- If you now believe the draft cannot meet Wikipedia's standards or do not wish to progress it further, you may request deletion. Please go to Draft:DildoLanka, click on the "Edit" tab at the top of the window, add "{{db-self}}" at the top of the draft text and click the blue "publish changes" button to save this edit.
- If you need any assistance, you can ask for help at the Articles for creation help desk or on the reviewer's talk page.
- You can also use Wikipedia's real-time chat help from experienced editors.
Hello, Dan arndt!
Having an article declined at Articles for Creation can be disappointing. If you are wondering why your article submission was declined, please post a question at the Articles for creation help desk. If you have any other questions about your editing experience, we'd love to help you at the Teahouse, a friendly space on Wikipedia where experienced editors lend a hand to help new editors like yourself! See you there! Dan arndt (talk) 06:42, 30 January 2019 (UTC)
|
Draft:Sanjay Chhimpa (Artist)
editHii Dan arndt It is mainly connected to important points of the singer's (Criteria for musicians and ensembles) 2,4,5,10,11,12, and the singer has played the role of singer in many Bollywood films of India, which is the main form It is clear that you are requested to carefully look at all the points and publish the draft. Thanks — Preceding unsigned comment added by Teamsgnr123 (talk • contribs) 12:39, 4 February 2019 (UTC)
Need assistance
editHi,
I'm a bit confused why you turned down my article. You noted that said articles only have a passing mention of my page Draft:Breakfast in Japan, but the external articles I chose are specifically about breakfasts in Japan. Can you please help with that?
Also, you seem to have noted that the webpages in citing must be independent from the subject. That makes sense if it is a business or such, but no one can actually own a breakfast style, so I can't help that.
Thanks,
--日・本 (talk) 22:38, 5 February 2019 (UTC) 日・本
Draft: Sayaji Industries Ltd.
editHi Dan arndt
Can you please re-review the draft article for Sayaji Industries. I have added more external references which are taken from authentic news sources. Also more information is added. — Preceding unsigned comment added by Dvpman (talk • contribs) 07:23, 6 February 2019 (UTC)
- If you wish Draft:Sayaji Industries Limited to be reviewed again you need to re-submit it for review. For what little it may be worth, if I was to review it I would come top exactly the same conclusion as Dan arndt did. This falls well short of any test of notability for a company. Velella Velella Talk 07:29, 6 February 2019 (UTC) (talk page stalker)
Amitesh Mishra needs a page of his own.
editAmitesh Mishra represents India at various events, have won many national level medals and participated at the 2018 Asian games in Jakarta. Why can't I make his Wikipedia page Pavitraputel (talk) 07:58, 6 February 2019 (UTC)
Hi Dan arndt,
I have done few modifications and as per your advice have included few independent links. Please do check and review. — Preceding unsigned comment added by Dvpman (talk • contribs) 11:00, 6 February 2019 (UTC)
New Article
editHello, you recently reviewed my new article Saikyoyaki for which I am very appreciative. If you would not mind to review another short article Draft:Karakudamono, it was submitted around the same time but I fear has been overlooked. I am scared I will forget about it if I do not hear back from someone about whether it is ok to be created. I would appreciate if you would please look at it. 犬ヶ崎 (talk) 09:59, 7 February 2019 (UTC)
Article Draft Copyright Question
editNew Article Draft Question Copyright
Dan, thanks for reviewing my draft of Hongju Lee clan. I can find the necessary references. I have a generalquestion about articles. If someone else were to publish this article in Wiki what rights does the original author have in regards to the content of the article? I am concerned that someone/something may create an article on that subject and then block others they disagree with. Thank you. Hjlresearcher16 — Preceding unsigned comment added by Hjlresearcher16 (talk • contribs) 12:52, 7 February 2019 (UTC) Hjlresearcher16 (talk) 12:55, 7 February 2019 (UTC)
Draft:Stats for most sports in tables
editIf you look it the link & select Rugby league at the top of the screen there you can find the info for nrl.and because of time i have not been able to put in the rest of the stats for one team. This aricle will be redone of the next week & will be back to be reviewed. Sorry for bad spelling i have dyslexia (not bad). Thanks for the — Preceding unsigned comment added by Lachlan Carr (talk • contribs) 09:57, 10 February 2019 (UTC)
Article rejection O.A.K. Sundar
editHi Can you provide more information on why it was rejected. It will be helpful to improve it and resubmit if there was reason associated with it. I had improved it by providing references based on earlier feedback from user Boleyn
Just went back and saw your comments on feedbacks. Just confused. This actor has acted in numerous movies as a support actor so his name doesn't popup much in news articles. Not sure exactly how to source more references. Can link to YouTube videos of his acting to specific minute. Does this mean an actor without top billing cannot have a wiki page? Thanks for taking your time to review submissions and adding feedback. It helps newcomers.
Thanks Arasksk (talk) 15:41, 11 February 2019 (UTC)
Article Rejection
editHi, you commented that it needs more secondary sources for reference. However, this article is about a TV show, whose reference is naturally mainly from its original channel's website. A somewhat similar show, Car SOS is in the same situation, which has main reference from NGC UK website. So, why should this one be rejected? --Heris (talk) 01:08, 14 February 2019 (UTC)
Article Rejection =
edithttps://en.wikipedia.org/wiki/Draft:Arthur_San_Juan
Hi Dan, you reject a page that i was creating for my grandfather Arthur San Juan (Known as Art rease), i do have birth certificates and things like that to ensure that indeed it's my grandfather, ando also there were comments on the site that the picture of him was a Studio Shoot picture, of course, i wasn't born, when he took this picture. I got it from my mom, who got it from her mom years ago. Any help on how to solve the situation to publis the web will be appreciated. Thanks in advance. — Preceding unsigned comment added by Tigresj (talk • contribs) 21:33, 20 February 2019 (UTC)
Jessica A Newell
editGiving it a second look, I think you rejected it because it was lacking references. We have the US Copyright documents for her songs so do I create a Bibliography/reference page at the end of the article and add info identifying the copyrighted material? I also referenced iTunes, Amazon Music, Spotify and YouTube. Her song “Stay” is also searchable on these media outlets just go on iTunes and search for Stay by Jessica Newell. Isn’t that a source reference? I’d also like to add a thumbnail picture. I tried to download but it was blocked. How can I fix the post and not have it rejected? Dan, writing on Wikipedia seems a little cryptic to me. Was trying to figure out why the Biography I added for my daughter was rejected. I used the Wikipedia bio of Sabrina Carpenter and Hunter Plake as examples and held true to the format. Plus it’s hard to tell if you want me to make edits and resubmit or what? Also I wanted to add a Thumbnail picture like other artists too. My email: chris.newell06@gmail.com. Can you email me as it’s less cryptic? Easier to figure out. Thanks Chris. Appreciate your guidance.
Newelchr (talk) 13:52, 22 February 2019 (UTC)
You can remove this notice at any time by removing the {{Talkback}} or {{Tb}} template.
real life
editany chance of being able to have a chat over beer/coffee/whatever in near future about possibility of trying to deal with - https://en.wikipedia.org/wiki/List_of_musical_acts_from_Western_Australia - in any way? sort of derivative of earlier conversations over the last year or so re the issues of sources and materials available (or not) to build up from a sea of red... JarrahTree 02:49, 1 March 2019 (UTC)
Draft:List of marine protected areas
editAt the draft, you wrote that there were no references added. There were, but it didn't show up correctly, so I changed it so it now shows up. Can you review the page once more ? — Preceding unsigned comment added by ScrapperJack (talk • contribs) 18:19, 1 March 2019 (UTC)
Help
editHi, I am the user who created the draft for the Jaguar Charity Pantomime Society.
May I first say that I am embarased I did not remove the Ice cream link sooner, it was for my personal bookmark.
Secondly I wanted to ask if you could provide me with a few more details and advice on how to improve my draft page and bring it up to scatch.
Hope this finds you well Joseph JoeLea591 (talk) 22:35, 1 March 2019 (UTC)
Order of the Silver Bat draft
editHello, I have just read your comment on my draft article "Order of the Silver Bat". I am not entirely certain why you believe it to be a hoax considering that the article is fully cited to official and reliable sources. The nature of the Order has meant that internet coverage has been near inexistent, I'd appreciate it if you could rectify this misunderstanding.
Gussie Fink-Nottle
Handy Backup draft
editHello, Dan! I just readed your statement about declining my article "Handy Backup". I'm a fan of this small backup software, and I guess why it has no article in Wikipedia about it; therefore, I want to make a small but good article about it. You put a statement that my article is an advertisement; I have no such intentions but I guess how to rework my text to make it more "neutral". All information and reviews in Internet about this product, including such resources as PCMag and PCworld, is positive (up to advertising intentions), and how I can make a "neutral and objective" opinion when I have only such sources?
In addition, I have used such pages as Iperius Backup as an example, and in my opinion, these pages have more "advertising" intentions than my page. What the page I must use as an example of a "good" article about backup software? Best regards, Loonieeex
Vinvibes Sandbox Review
editHi, it was an experiment wherein I wanted to try out what happened if you put content in the sandbox. I would like to delete the content which is currently there and for that I have pasted a short code also. Is there anything else that I should do to get the existing content deleted? Asking because I do have an article in draft stage which I would like to put up for review. Thanks in advance, Vinvibes
well you declined it
editwhy did you declined my original user data and my posts. and how trailer and website for server not related to the server?
from jojocrafty
declined my original user data
editwhy did you declined my original user data. like how is talk about sefth in your user data wrong your user page is about you so why do deteted my own history I understand post I made about the server but why my user data we did you decline my original user data.
from jojocrafty
dr Milan Kašanin
editHi, could you please help me with the article https://en.wikipedia.org/wiki/Draft:Milan_Kašanin and getting a review. I've been working on it for a while now.
Thank you in advance.
Cut and paste move
editHi, and thank you for your contributions to Wikipedia. It appears that you tried to give Prime Minister's Cottage a different title by copying its content and pasting either the same content, or an edited version of it, into Prime Minister's Lodge. This is known as a "cut-and-paste move", and it is undesirable because it splits the page history, which is legally required for attribution. Instead, the software used by Wikipedia has a feature that allows pages to be moved to a new title together with their edit history.
In most cases, once your account is four days old and has ten edits, you should be able to move an article yourself using the "Move" tab at the top of the page (the tab may be hidden in a dropdown menu for you). This both preserves the page history intact and automatically creates a redirect from the old title to the new. If you cannot perform a particular page move yourself this way (e.g. because a page already exists at the target title), please follow the instructions at requested moves to have it moved by someone else. Also, if there are any other pages that you moved by copying and pasting, even if it was a long time ago, please list them at Wikipedia:Requests for history merge. Thank you. Obi2canibe (talk) 18:44, 3 March 2019 (UTC)
Vavuniya Saivapragasa Primary School
editPlz create a template box for it Thiyagasothy (talk) 02:24, 4 March 2019 (UTC)
- LaddieJohn (talk · contribs)
Dear reviewer.
As new to wikipedia please accept my apologies if I ask questions that seem naive or simple to answer. Issue is that i created a draft page for Hellenic malt Whisky Society and it is rejected due to lack of references.
As a Society based in Greece, we do have more than 9 years of history as a dedicated group and more than 13 years of involvement with whisky tasting and appreciation.
But, all these years we used our whiskyforum in order to support our tasks and (the word is not correct but we can use it) to advertise our events, knowledge basis etc.
To this aim, there exist articles that refer to whiskyforum which is officially powered and supported and of course owned by HMWS.
We have articles in Greek-radar.gr / zougla.gr https://www.zougla.gr/blog/article/235723 / the world No1 resource for whisky, the famous whiskyfun page owned by Serge Valentine http://www.whiskyfun.com/Whisky-Links.html / a mention about the best Greek forums in toxrisimo.gr https://www.toxrisimo.gr/2018/09/ta-kalutera-ellhnika-forum.html?m=1
Still, I cannot really understand what is needed to have an "official" reference to HMWS. Please advise.
Good_Shed_Bus_Station,_Kandy
editDraft:Good Shed Bus Station, Kandy I have updated secondary and further sources for this public place. Please take a moment to review. NirvanaTodayt@lk 10:03, 7 March 2019 (UTC)
they all appear to be just a series of mentions in passing nothing more.
editPlease, can you clarify this? " they all appear to be just a series of mentions in passing nothing more. ". I'm bit confused how to add sources for a public bus stand of a big city in Sri Lanka. I'm trying to complete Structures of Kandy category - Thank you, Kindly NirvanaTodayt@lk 11:16, 7 March 2019 (UTC)
- This is the second largest bus stand in Sri Lanka which is currently undergoing massive changes. What sort of supporting information other than all those sources you're looking for? NirvanaTodayt@lk 11:21, 7 March 2019 (UTC)
- I have added a university study which explains 3 main bus stands in Kandy - [2] Page 2-9 - 2.6.3 Bus Transport - Please check if this is a sufficient reference. – NirvanaTodayt@lk 09:50, 8 March 2019 (UTC)
DYK for Former General Post Office, Colombo
editOn 10 March 2019, Did you know was updated with a fact from the article Former General Post Office, Colombo, which you recently created, substantially expanded, or brought to good article status. The fact was ... that the first telephone booth in Ceylon was installed at the Colombo General Post Office on 16 August 1909? The nomination discussion and review may be seen at Template:Did you know nominations/Former General Post Office, Colombo. You are welcome to check how many page hits the article got while on the front page (here's how, Former General Post Office, Colombo), and it may be added to the statistics page if the total is over 5,000. Finally, if you know of an interesting fact from another recently created article, then please feel free to suggest it on the Did you know talk page.
NPR Newsletter No.17
editHello Dan arndt,
- News
- The WMF has announced that Google Translate is now available for translating articles through the content translation tool. This may result in an increase in machine translated articles in the New Pages Feed. Feel free to use the {{rough translation}} tag and gently remind (or inform) editors that translations from other language Wikipedia pages still require attribution per WP:TFOLWP.
- Discussions of interest
- Two elements of CSD G6 have been split into their own criteria: R4 for redirects in the "File:" namespace with the same name as a file or redirect at Wikimedia Commons (Discussion), and G14 for disambiguation pages which disambiguate zero pages, or have "(disambiguation)" in the title but disambiguate a single page (Discussion).
- {{db-blankdraft}} was merged into G13 (Discussion)
- A discussion recently closed with no consensus on whether to create a subject-specific notability guideline for theatrical plays.
- There is an ongoing discussion on a proposal to create subject-specific notability guidelines for chemicals and organism taxa.
- Reminders
- NPR is not a binary keep / delete process. In many cases a redirect may be appropriate. The deletion policy and its associated guideline clearly emphasise that not all unsuitable articles must be deleted. Redirects are not contentious. See a classic example of the templates to use. More templates are listed at the R template index. Reviewers who are not aware, do please take this into consideration before PROD, CSD, and especially AfD because not even all admins are aware of such policies, and many NAC do not have a full knowledge of them.
- NPP Tools Report
- Superlinks – allows you to check an article's history, logs, talk page, NPP flowchart (on unpatrolled pages) and more without navigating away from the article itself.
- copyvio-check – automatically checks the copyvio percentage of new pages in the background and displays this info with a link to the report in the 'info' panel of the Page curation toolbar.
- The NPP flowchart now has clickable hyperlinks.
Six Month Queue Data: Today – Low – 2393 High – 4828
Looking for inspiration? There are approximately 1000 female biographies to review.
Stay up to date with even more news – subscribe to The Signpost.
Go here to remove your name if you wish to opt-out of future mailings.
--MediaWiki message delivery (talk) 23:18, 15 March 2019 (UTC)
Dan arndt, the nominator has responded to your review here. Please return when you get the chance to see whether the issues you were concerned about have been addressed. Many thanks. BlueMoonset (talk) 01:44, 9 March 2019 (UTC)
- Dan arndt, another ping about returning to your review of this nomination. If you don't wish to continue the review, please let me know and I'll look for a new reviewer. Thank you. BlueMoonset (talk) 18:59, 17 March 2019 (UTC)
Orphaned non-free image File:Birdsoftokyo dayone.jpg
editThanks for uploading File:Birdsoftokyo dayone.jpg. The image description page currently specifies that the image is non-free and may only be used on Wikipedia under a claim of fair use. However, the image is currently not used in any articles on Wikipedia. If the image was previously in an article, please go to the article and see why it was removed. You may add it back if you think that that will be useful. However, please note that images for which a replacement could be created are not acceptable for use on Wikipedia (see our policy for non-free media).
Note that any non-free images not used in any articles will be deleted after seven days, as described in section F5 of the criteria for speedy deletion. Thank you. --B-bot (talk) 02:24, 20 March 2019 (UTC)
Orphaned non-free image File:Zombiescover-1-.jpg
editThanks for uploading File:Zombiescover-1-.jpg. The image description page currently specifies that the image is non-free and may only be used on Wikipedia under a claim of fair use. However, the image is currently not used in any articles on Wikipedia. If the image was previously in an article, please go to the article and see why it was removed. You may add it back if you think that that will be useful. However, please note that images for which a replacement could be created are not acceptable for use on Wikipedia (see our policy for non-free media).
Note that any non-free images not used in any articles will be deleted after seven days, as described in section F5 of the criteria for speedy deletion. Thank you. --B-bot (talk) 17:50, 21 March 2019 (UTC)
Draft
editHello Dan arndt, Thank you for checking my article Minaret Kabir , which you did in January. I wonder if you could put time and check my other article which is in draft, Draft:Baskut Tuncak . I have worked on it a few times. Please tell me if it needs anything else that i have to do. Thank you. Alex-h (talk) 23:45, 19 March 2019 (UTC)
Hello dan randy don't edit anymore in pandarikulam I kindly request you please Thiyagasothy (talk) 00:43, 25 March 2019 (UTC)
Talkback
editMessage added 02:33, 31 March 2019 (UTC). You can remove this notice at any time by removing the {{Talkback}} or {{Tb}} template.
You rejected the draft article that someone created last October. I think that may have been in error. One of their videos has 23 million views on YouTube, another has 8 million, another has 6 million, and so forth. They've been around for years, have toured Europe, they have played at WOMAD and elsewhere. There are articles about them even in the Danish and Hungarian Wikipedias, and obviously in Russian Wikipedia. I think that deletionism was an overreaction. -- P.T. Aufrette (talk) 19:01, 4 April 2019 (UTC)
Your draft article, Draft:Colonel Aqeel Ahmed
editHello, Dan arndt. It has been over six months since you last edited the Articles for Creation submission or Draft page you started, "Colonel Aqeel Ahmed".
In accordance with our policy that Wikipedia is not for the indefinite hosting of material deemed unsuitable for the encyclopedia mainspace, the draft has been nominated for deletion. If you plan on working on it further, or editing it to address the issues raised if it was declined, simply and remove the {{db-afc}}
, {{db-draft}}
, or {{db-g13}}
code.
If your submission has already been deleted by the time you get there, and you wish to retrieve it, you can request its undeletion by following the instructions at this link. An administrator will, in most cases, restore the submission so you can continue to work on it.
Thanks for your submission to Wikipedia, and happy editing. DannyS712 (talk) 08:31, 6 April 2019 (UTC)
Hi there! I hope I'm not bothering, but I would very much appreciate some comments on my current FLC linked above →. Just disregard if you're too busy at the moment. Many thanks and have yourself a good day Cartoon network freak (talk) 07:25, 14 April 2019 (UTC)
Disambiguation link notification for April 25
editHi. Thank you for your recent edits. An automated process has detected that when you recently edited Savoy Cinema, Colombo, you added a link pointing to the disambiguation page Cinema (check to confirm | fix with Dab solver). Such links are usually incorrect, since a disambiguation page is merely a list of unrelated topics with similar titles. (Read the FAQ • Join us at the DPL WikiProject.)
It's OK to remove this message. Also, to stop receiving these messages, follow these opt-out instructions. Thanks, DPL bot (talk) 09:10, 25 April 2019 (UTC)
NPR Newsletter No.18
editHello Dan arndt,
- WMF at work on NPP Improvements
Niharika Kohli, a product manager for the growth team, announced that work is underway in implementing improvements to New Page Patrol as part of the 2019 Community Wishlist and suggests all who are interested watch the project page on meta. Two requested improvements have already been completed. These are:
- Allow filtering by no citations in page curation
- Not having CSD and PRODs automatically marked as reviewed, reflecting current consensus among reviewers and current Twinkle functionality.
- Reliable Sources for NPP
Rosguill has been compiling a list of reliable sources across countries and industries that can be used by new page patrollers to help judge whether an article topic is notable or not. At this point further discussion is needed about if and how this list should be used. Please consider joining the discussion about how this potentially valuable resource should be developed and used.
- Backlog drive coming soon
Look for information on the an upcoming backlog drive in our next newsletter. If you'd like to help plan this drive, join in the discussion on the New Page Patrol talk page.
- News
- Following a request for comment, the subject-specific notability guideline for pornographic actors and models (WP:PORNBIO) was removed; in its place, editors should consult WP:ENT and WP:GNG.
- Discussions of interest
- A request for bot approval for a bot to patrol two kinds of redirects
- There has been a lot discussion about Notability of Academics
- What, if anything, would a SNG for Softball look like
Six Month Queue Data: Today – 7242 Low – 2393 High – 7250
Stay up to date with even more news – subscribe to The Signpost.
Go here to remove your name if you wish to opt-out of future mailings.
Delivered by MediaWiki message delivery (talk) on behalf of DannyS712 (talk) at 19:17, 17 May 2019 (UTC)
A barnstar for you!
editThe Original Barnstar | |
The Best For You Sir Ebenezer2nd (talk) 11:08, 23 May 2019 (UTC) |
Dear Dan. Globina has over 350K following on Instagram and 18K on facebook and she is verified musician. She has a trademark at Patentverket for her being musician. Are these things not enough for having a wikipedia article? She will also be featured in a movie together with Pierce Brosnan where she is playing herself a DJ. Please assist me so a correct article
Bandaranayake College Gampaha
editThank you for your past edits. You had recently removed the Clubs & Societies and the Sports sections from Bandaranayake College Gampaha stating they are extra details. But most of the schools in Sri Lanka have those details, So I was wondering if it'll be alright to reinstate those details. Sahan0710 (talk) 14:39, 7 May 2019 (UTC)
Thank you for looking towards our school article. I was wondering why these details (Clubs and Societies) were removed from Bandaranayake College Gampaha while it is available in the Sinhala language article itself. So it creates a difference between the English and Sinhala translations of the article. And also Clubs and Societies of Bandaranayake College Gampaha has some differences than other schools. So we are interested in noting them exclusively in the English article. ThathsaraWTh (talk) 04:05, 26 May 2019 (UTC)
Anoka Primrose Abeyrathne
editHi, I see you are active in the Sri Lanka project. I was wondering if you could advise on the article Anoka Primrose Abeyrathne or suggest another editor who might be able to. Firstly I think the article needs Sinhala (and Tamil?) version's of her name. Secondly I am hoping to find someone who has some knowledge of charities in Sri Lanka, as I would like to find out where her organisation Sustain Solutions is registered, if they are a charity or not for profit and if they publish an annual report in English.TSventon (talk) 19:46, 6 June 2019 (UTC)
Your submission at Articles for creation: G. K. W. Perera has been accepted
editYou are more than welcome to continue making quality contributions to Wikipedia. If your account is more than four days old and you have made at least 10 edits you can create articles yourself without posting a request. However, you may continue submitting work to Articles for Creation if you prefer.
- If you have any questions, you are welcome to ask at the help desk.
- If you would like to help us improve this process, please consider .
Thank you for helping improve Wikipedia!
Dan arndt (talk) 08:31, 11 June 2019 (UTC)MY ARTICLE DOES MEET CRITERIA TO BE ACCEPTED. — Preceding unsigned comment added by Blue2020 (talk • contribs) 03:18, 13 June 2019 (UTC)
Indian English
editThe correct spelling using Indian English is metres not meters and organisation not organization. Dan arndt (talk) 14:56, 18 June 2019 (UTC)
- Well, organisation/organization can go either way, I think both are ok, metres, yes you're right. I guess I've just been on the periphery of a few too many petty/pointless ENGVAR squabbles lately, and I find them irritating, so I reacted to your innocent edit. No offense intended in any case - my apologies. -- Begoon 15:17, 18 June 2019 (UTC)
Your submission at Articles for creation: Samuel Harward has been accepted
editThe article has been assessed as Start-Class, which is recorded on the article's talk page. You may like to take a look at the grading scheme to see how you can improve the article.
You are more than welcome to continue making quality contributions to Wikipedia. If your account is more than four days old and you have made at least 10 edits you can create articles yourself without posting a request. However, you may continue submitting work to Articles for Creation if you prefer.
- If you have any questions, you are welcome to ask at the help desk.
- If you would like to help us improve this process, please consider .
Thank you for helping improve Wikipedia!
DGG ( talk ) 00:27, 29 June 2019 (UTC)New Page Review newsletter July-August 2019
editHello Dan arndt,
- WMF at work on NPP Improvements
More new features are being added to the feed, including the important red alert for previously deleted pages. This will only work if it is selected in your filters. Best is to 'select all'. Do take a moment to check out all the new features if you have not already done so. If anything is not working as it should, please let us know at NPR. There is now also a live queue of AfC submissions in the New Pages Feed. Feel free to review AfCs, but bear in mind that NPP is an official process and policy and is more important.
- QUALITY of REVIEWING
Articles are still not always being checked thoroughly enough. If you are not sure what to do, leave the article for a more experienced reviewer. Please be on the alert for any incongruities in patrolling and help your colleagues where possible; report patrollers and autopatrolled article creators who are ostensibly undeclared paid editors. The displayed ORES alerts offer a greater 'at-a-glance' overview, but the new challenges in detecting unwanted new content and sub-standard reviewing do not necessarily make patrolling any easier, nevertheless the work may have a renewed interest factor of a different kind. A vibrant community of reviewers is always ready to help at NPR.
- Backlog
The backlog is still far too high at between 7,000 and 8,000. Of around 700 user rights holders, 80% of the reviewing is being done by just TWO users. In the light of more and more subtle advertising and undeclared paid editing, New Page Reviewing is becoming more critical than ever.
- Move to draft
NPR is triage, it is not a clean up clinic. This move feature is not limited to bios so you may have to slightly re-edit the text in the template before you save the move. Anything that is not fit for mainspace but which might have some promise can be draftified - particularly very poor English and machine and other low quality translations.
- Notifying users
Remember to use the message feature if you are just tagging an article for maintenance rather than deletion. Otherwise articles are likely to remain perma-tagged. Many creators are SPA and have no intention of returning to Wikipedia. Use the feature too for leaving a friendly note note for the author of a first article you found well made or interesting. Many have told us they find such comments particularly welcoming and encouraging.
- PERM
Admins are now taking advantage of the new time-limited user rights feature. If you have recently been accorded NPR, do check your user rights to see if this affects you. Depending on your user account preferences, you may receive automated notifications of your rights changes. Requests for permissions are not mini-RfAs. Helpful comments are welcome if absolutely necessary, but the bot does a lot of the work and the final decision is reserved for admins who do thorough research anyway.
- Other news
School and academic holidays will begin soon in various places around the Western world. Be on the lookout for the usual increase in hoax, attack, and other junk pages.
Our next newsletter might be announcing details of a possible election for co-ordinators of NPR. If you think you have what it takes to micro manage NPR, take a look at New Page Review Coordinators - it's a job that requires a lot of time and dedication.
Stay up to date with even more news – subscribe to The Signpost.
Go here to remove your name if you wish to opt-out of future mailings.
Dujuan Thomas
editDan arndt couldn't draft Dujuan Thomas be considered a WP:ENT ? with his large following, contribuitions to the modeling and fashion industry with works including celebrities, and his role in film and websites. — Preceding unsigned comment added by Abbycarroll (talk • contribs) 08:24, 4 July 2019 (UTC)
Thanks for source - Family Gear
editThanks for the source on Yankee Bicycle Company. I will incorporate it into the draft article on Yankee Bicycle Company - probably under a new section about the founder Royce Husted .I searched high and low. Just so I learn to do better research, what sequence did you use to find this article?
FYI - I volunteer at Working Bikes and we received this odd bike - turned out to be a Yankee Bike. None of us had seen anything like this bike. It was in superb shape needing only a clean up. We put it onto the "as is" bike pile and it was picked up for only $45 within half an hour. From your source, I'm guessing, they built maybe only 3,000 bikes (I'm hoping additional contributing editors will come up with a better count supported by a good source). A Working Bikes customer got a great deal for a collector bike! If I had known what it was I would have bought it myself at that price for the bragging rights and maybe the investment op - saw one ad, since doing the research, requesting $350. Pkon99 (talk) 17:57, 5 July 2019 (UTC)
Afd
editIf an editor recreates an article that was deleted after Afd, like DilJco has done with Hemachandra Wijeratne, you request speedy deletion under WP:G4 rather than request another Afd discussion.--Obi2canibe (talk) 11:28, 6 July 2019 (UTC)
Jack Bin
editYou all block everything I post, so can you unblock this article or can you make it for me please dan? — Preceding unsigned comment added by 2605:A000:B109:5100:7025:561B:4807:D0BD (talk) 05:07, 8 July 2019 (UTC)
American Political Thought: A Journal of Ideas, Institutions, and Culture
editThank you for considering my submission of a new article entitled "American Political Thought: A Journal of Ideas, Institutions, and Culture." As suggested, I went back to the draft of the article and added numerous "independent reliable secondary sources." Is there a way for me to submit the article again for consideration now that I have solved this problem? — Preceding unsigned comment added by Laurenlewis (talk • contribs) 21:22, 10 July 2019 (UTC)
Citations included
editHi Dan, thanks for your advise. Have included citations on Patrick J Casey bio. Thanks. Eddy Leman (talk) 04:13, 12 July 2019 (UTC)
July 2019
editTeenager tee you free book loop move Guppies1234 (talk) 05:36, 17 July 2019 (UTC)
Hello
editI just called to say hello... — Preceding unsigned comment added by Guppies1234 (talk • contribs) 04:17, 18 July 2019 (UTC)
Dereck Stewart
editHello Dan, I just wrote my first Wikipedia entry about the first African American heading the THP. Unfortunately it was rejected. But I can't understand the reasons. Could you please give me some hints? That would be fantastic! (Mauerwerk (talk) 20:15, 16 July 2019 (UTC))
Hello Dan, thanks for your reply! I still struggle with the concept of a "notable achievement". How is it defined by Wikipedia? Doesn't the fact the organisation exist for 89 years, yet that Dereck Stewart is its first African-American head demonstrate that he accomplished a "notable achievement"? (Mauerwerk (talk) 06:58, 18 July 2019 (UTC))
Hello Dan, it's me again. I still wonder about the "notable achievement" characteristic. Let's take for instance "M. H. Sims". He was head football coach for the Northwest Missouri State University Bearcats. To me this is a far smaller achievement than becoming the first African-American presiding the THP. Hence, could you please provide me with a definition of "notable achievement" or with some links etc.? That would be fantastic! Thanks & cheers! (Mauerwerk (talk) 05:47, 19 July 2019 (UTC))
Reject vs. decline
editArticles for creation submitters have been asking a lot of questions at the AfC Help Desk about drafts you've rejected. That isn't necessarily a bad thing, it shows you're reviewing many drafts, which is much appreciated.
But on some, such as User:Mikedc73/Mornington Cinema, you are sending mixed messages. The reject option (as opposed to merely decline) should be reserved for "topics entirely unsuitable for Wikipedia" – subjects that will never, ever, under any circumstances, be accepted, no matter how much the author edits them. If there's anything they can do to "fix" the draft, as you tell them in your comment on this example, then the draft should not be rejected, but should be declined, so they can resubmit it after correcting the problem. --Worldbruce (talk) 15:00, 2 July 2019 (UTC)
@Dan arndt:, I'd like to echo the concerns above regarding your use of 'reject' instead of 'decline'. The idea behind introducing the 'reject' option was so that if the author repeatedly re-submits a draft without addressing the issues raised in the decline messages then we can send a clear message of 'STOP' to the author. It can also be used when a draft has zero hope of ever becoming an article. It wasn't intended to be used where the author could improve the draft such as by adding references that show that the subject is notable. Can you engage with us here in response to these concerns? Curb Safe Charmer (talk) 10:52, 18 July 2019 (UTC)
- @Dan arndt: - I just wanted to drop my own concerns on this - I handle a lot of queries on AFC/HD where this shows up. You're always right that they shouldn't be accepted, but a significant number of those tagged reject could probably be articles if sourced properly. Nosebagbear (talk) 10:55, 19 July 2019 (UTC)
- There are now four comments from four different editors (five if you include me) spanning two weeks regarding this issue, and yet I do not see any reply or attempts to curb the number of rejections. As you may have seen I reverted one of your reviews yesterday as it was not appropriate to reject out-of-hand. I would really like to see a response with your thoughts and comments here before I kick it up the chain and go to WP:AFC for a larger group discussion. Primefac (talk) 11:30, 19 July 2019 (UTC)
- Make that six. I've helped several people on IRC who have had trouble understanding your reviews with extremely short comments and selected reasons often entirely omitted. The goal isn't to make the backlog number lower at all costs; it's to help new editors. KSFT (t|c) 03:17, 20 July 2019 (UTC)
- I've opened a thread regarding these concerns. Primefac (talk) 18:41, 22 July 2019 (UTC)
- Rather than respond to the above concerns individually I have posted a reply on the thread created by Primefac. Dan arndt (talk) 02:22, 23 July 2019 (UTC)
Sonny West (musician)
editHi Dan, I have re-submitted an article that was declined with some edits, could you please have a look and let me know if thats suitable and give me some directions about it. Thanks--Elifnurk (talk) 13:26, 22 July 2019 (UTC)
Done - have edited the page and approved it. Dan arndt (talk) 02:25, 23 July 2019 (UTC)
Your submission at Articles for creation: MAK (Manickam Athapa Kounder) (July 25)
edit- If you would like to continue working on the submission, go to Draft:MAK (Manickam Athapa Kounder) and click on the "Edit" tab at the top of the window.
- If you now believe the draft cannot meet Wikipedia's standards or do not wish to progress it further, you may request deletion. Please go to Draft:MAK (Manickam Athapa Kounder), click on the "Edit" tab at the top of the window, add "{{db-self}}" at the top of the draft text and click the blue "publish changes" button to save this edit.
- If you do not make any further changes to your draft, in 6 months, it will be considered abandoned and may be deleted.
- If you need any assistance, you can ask for help at the Articles for creation help desk, on the reviewer's talk page or use Wikipedia's real-time chat help from experienced editors.
Hello, Dan arndt!
Having an article declined at Articles for Creation can be disappointing. If you are wondering why your article submission was declined, please post a question at the Articles for creation help desk. If you have any other questions about your editing experience, we'd love to help you at the Teahouse, a friendly space on Wikipedia where experienced editors lend a hand to help new editors like yourself! See you there! Curb Safe Charmer (talk) 12:27, 25 July 2019 (UTC)
|
Mario Grigorov
editDan, I have made loads of changes, could you please give me more feedback now, thanksElifnurk
- Feedback provided. Dan arndt (talk) 02:25, 23 July 2019 (UTC)
Hi Dan, I have once again submitted with several corrections, can I please have a feedback. ThanksElifnurk (talk) 21:18, 25 July 2019 (UTC)
follow up to rejected submissions 2019-20 FA Trophy and 2019-20 FA Vase - new content added
editDan, I am a different user than the one who initially submitted these pages. I have updated the competition with draws for the first two rounds, which were unknown at the time of the original submission. I am hoping this is satisfactory to get these pages added, and I'm sure additional source links will be added once the page is live. These competitions start very soon, it would be nice to have them posted as in past years.
[Update] Sorry, messed up the links to the draft pages. Should be fixed now.
Hi Dan, I have made several changes and worked on some more references, could you please give me some more feedback? Thanks Elifnurk (talk) 13:04, 2 August 2019 (UTC)
DYK for Sonny West (musician)
editOn 7 August 2019, Did you know was updated with a fact from the article Sonny West (musician), which you recently created, substantially expanded, or brought to good article status. The fact was ... that Sonny West (pictured), the co-writer of Buddy Holly's hits "Oh, Boy!" and "Rave On", took 40 years to finish the follow-up songs? The nomination discussion and review may be seen at Template:Did you know nominations/Sonny West (musician). You are welcome to check how many page hits the article got while on the front page (here's how, Sonny West (musician)), and it may be added to the statistics page if the total is over 5,000. Finally, if you know of an interesting fact from another recently created article, then please feel free to suggest it on the Did you know talk page.
A barnstar for you!
editThe Original Barnstar | |
Congrats on getting this achievement! You earned it!
Thurmondt (talk) 23:38, 8 August 2019 (UTC) |
A barnstar for you!
editThe Original Barnstar | |
I appreciate your efforts contributing in the Wikipedia website. Thanks for making this world more knowledgeable. محمدظہیر (talk) 08:37, 10 August 2019 (UTC) |
Draft:Victor Targulian
editHello, Dan arndt... Thank you very much for reviewing my article Draft:Victor Targulian. The article was rejected due to lack of references. Now I have inserted the necessary links. Could you, if you have time, look at my article again? Thanks Zeits (talk) 11:04, 10 August 2019 (UTC)
Hello there. You declined my draft saying it duplicates content at Wikipedia:Vandalism, but I feel like you did not clarify how my essay duplicates content. I searched through the entire policy to look for anything about reacting to someone who reverted vandalism before another editor in an edit conflict. Can you please pinpoint where the content of my essay is located in the policy. Also, if ever you are right, I will, if possible, move the essay to my userspace, so I would like information about that to. I hope you see this and reply, which I would appreciate. Again, thank you very much for taking the time to read this. LPS and MLP Fan (LittlestPetShop) (MyLittlePony) 15:13, 12 August 2019 (UTC)
Non-free rationale for File:Lolly Gobble Bliss Bomb.jpeg
editThanks for uploading or contributing to File:Lolly Gobble Bliss Bomb.jpeg. I notice the file page specifies that the file is being used under non-free content criteria, but there is not a suitable explanation or rationale as to why each specific use in Wikipedia is acceptable. Please go to the file description page, and edit it to include a non-free rationale.
If you have uploaded other non-free media, consider checking that you have specified the non-free rationale on those pages too. You can find a list of 'file' pages you have edited by clicking on the "my contributions" link (it is located at the very top of any Wikipedia page when you are logged in), and then selecting "File" from the dropdown box. Note that any non-free media lacking such an explanation will be deleted one week after they have been tagged, as described in section F6 of the criteria for speedy deletion. If the file is already gone, you can still make a request for undeletion and ask for a chance to fix the problem. If you have any questions, please ask them at the Media copyright questions page. Thank you. Ubcule (talk) 13:19, 10 August 2019 (UTC)
- Additional notes; Thank you for your contribution. However, I've had to convert the license on this from "PD" to "non-free fair use" as it's a straightforward reproduction of copyrighted product packaging, and only usable here under those terms.
- Can you please add the rationale for its inclusion in both article it's currently featured in?
- Personally, I'm not 100% sure if it belongs in List of popcorn brands, as there is some dispute over how many- if any- non-free images can be used in list articles. See here for more details if you want it included. Thanks, Ubcule (talk) 13:19, 10 August 2019 (UTC)
- I notice that you removed the {{Di-no fair use rationale}} template and altered the {{Non-free product cover}} one to indicate that a rationale had been supplied.
- However, this hasn't actually been done for either article the image appears in.
- I'm guessing this is an oversight and that- since you appear to be an experienced user- you're familiar with how to add the rationale. However, if you require help, please don't hesitate to ask via the usual channels. Thanks,
- Ubcule (talk) 20:53, 13 August 2019 (UTC)
Some baklava for you!
editThanks for your review on my article.. I will try to do the needful.. Israelites665 (talk) 10:53, 22 August 2019 (UTC) |
- ITLRosanna (talk · contribs)
Hi! Thank you for looking at my article, I appreciate your feedback. I see on the Wikipedia music notability guidelines page the following criteria for notability: (that the artist) Has had a single or album on any country's national music chart. Vic Sage had a single in Spotify's viral 50 chart in Canada and Australia. Also, his album Low Key was on Apple Music's top 100 chart. I understand that Spotify and Apple Music on their own are not reliable references, however their charts are newly becoming benchmarks of who is sharing music digitally in the US and worldwide. Would focusing on the artist's album and song that made it on those charts help? Thank you!! (ITLRosanna (talk) 13:59, 22 August 2019 (UTC))
- ModernPixels (talk · contribs)
I am requesting assistance for the page I have written for Left at London (https://en.wikipedia.org/wiki/Draft:Left_at_London). The problem that I have is with citing specific dates such as the release of albums or specific videos uploaded online. I have not found any articles that specifically mention the dates of these, with the only way to find the date is through the original upload. Is there any way that I can cite the social media uploads since there is no articles that mention the dates?
Disambiguation link notification for August 23
editAn automated process has detected that when you recently edited Katunayake, you added a link pointing to the disambiguation page Board of Investment (check to confirm | fix with Dab solver).
(Opt-out instructions.) --DPL bot (talk) 07:38, 23 August 2019 (UTC)
Hi Dan arndt, I wanted to let you know that I reverted your decline at AfC of Draft:Polyalkylene glycols. The material that you identified as copyright material is actually public domain. You may not be aware, but unless otherwise noted, material produced by the US federal government is public domain. We want to be very vigilant about copyright issues, and I commend your vigilance. I do understand that this is easy to miss sometimes. Best wishes to you and thanks for all your work. Waggie (talk) 02:48, 29 August 2019 (UTC)
Sri Lankan Barnstar of National Merit
editThe Sri Lankan Barnstar of National Merit | ||
Thankyou for your hard work on Sri Lankan topics and contributing to the Asian Challenge! My message was aimed at getting more ative editors from Sri Lanka involved that's all, I've noticed your work in the past! | ||
this WikiAward was given to Dan arndt by ♦ Dr. Blofeld 06:46, 28 August 2019 (UTC) |
Yes sir! This person should be awarded the "chicken 64 of the year" medal!!! Poiuyt4321 (talk) 03:06, 31 August 2019 (UTC)
Yes sir! This person should be awarded the "chicken 64 of the year" medal!!! Poiuyt4321 (talk) 03:06, 31 August 2019 (UTC)
Yes sir! This person should be awarded the "chicken 64 of the year" medal!!! Poiuyt4321 (talk) 03:07, 31 August 2019 (UTC)
Yes sir! This person should be awarded the "chicken 64 of the year" medal!!! Poiuyt4321 (talk) 03:07, 31 August 2019 (UTC)
Yes sir! This person should be awarded the "chicken 64 of the year" medal!!! Poiuyt4321 (talk) 03:07, 31 August 2019 (UTC)
Yes sir! This person should be awarded the "chicken 64 of the year" medal!!! Poiuyt4321 (talk) 03:07, 31 August 2019 (UTC)
A kitten for you!
editDear Dan, you are right. The article is not in English, is in Romanian (Know Simona Halep, Nadia and Ceausescu Ș) I will 1. publish in Ro wiki 2. Translate and resubmit Kind regards, Anca Pop AKA Alis 718
Alis718 (talk) 11:14, 25 August 2019 (UTC)
Ok. Good. Whatever! Poiuyt4321 (talk) 03:08, 31 August 2019 (UTC)
Hi Dan Arndt, My article was rejected for want of secondary sources. Here is a newspaper article about my book-https://www.abc-7.com/story/40938086/author-from-india-publishes-fantasy-novel. Please have my article accepted now. — Preceding unsigned comment added by Colaguy101 (talk • contribs) 14:06, 31 August 2019 (UTC)
Editor of journal vs Volumes
editHi Dan,
Thanks for your feedback regarding what I am editing (https://en.m.wikipedia.org/wiki/Draft:Shyam_Wuppuluri). Let me clarify a couple of things:
- Firstly he is not an editor of journal but has published five highly interdisciplinary volumes with Springer which are widely received.
- The subject does meet the notability standards “The person's academic work has made a significant impact in the area of higher education, affecting a substantial number of academic institutions.” Could you elaborate on what you’re exactly looking for?
Also, if I may ask, are you from academia or do you have some background in science?
Many thanks,
Page Moves to the Real Name
editHi Dan,
Can you explain why moving Draft:Emil Reif and Draft:Lukas Rossander was needed? The people in the Esports Taskforce have told me that the more used name (in this case that's the nickname) should be used as the title as per WP:STAGENAME. Lxxl (talk) 21:48, 4 September 2019 (UTC)
Excess warning templates
editCommunity Insights Survey
editShare your experience in this survey
Hi Dan arndt/Archive 15,
The Wikimedia Foundation is asking for your feedback in a survey about your experience with Wikipedia and Wikimedia. The purpose of this survey is to learn how well the Foundation is supporting your work on wiki and how we can change or improve things in the future. The opinions you share will directly affect the current and future work of the Wikimedia Foundation.
Please take 15 to 25 minutes to give your feedback through this survey. It is available in various languages.
This survey is hosted by a third-party and governed by this privacy statement (in English).
Find more information about this project. Email us if you have any questions, or if you don't want to receive future messages about taking this survey.
Sincerely,
Created Pages Moved To Edit
editI recently created 3 new pages (2019-20 FA Cup Qualifying Round, 2019-20 FA Trophy and 2019-20 FA Vase) these were then moved to Draft as they lacked and do "not have enough sources and citations as written to remain published." I then added a source (the only one available at the moment for each page and yet again they were moved to Draft.
If that's the case can you then please tell me why the pages for 2018-19 FA Trophy and 2018-19 FA Vase remain available to be published as Trophy page has no linked references and the Vase page only has one linked reference?
Last seasons pages were created around the same time last year and without references with one of those pages (2018-19 FA Trophy) still having no references, so why where they allowed to be displayed but not now?
New Page Review newsletter September-October 2019
editHello Dan arndt,
- Backlog
Instead of reaching a magic 300 as it once did last year, the backlog approaching 6,000 is still far too high. An effort is also needed to ensure that older unsuitable older pages at the back of the queue do not get automatically indexed for Google.
- Coordinator
A proposal is taking place here to confirm a nominated user as Coordinator of NPR.
- This month's refresher course
Why I Hate Speedy Deleters, a 2008 essay by long since retired Ballonman, is still as valid today. Those of us who patrol large numbers of new pages can be forgiven for making the occasional mistake while others can learn from their 'beginner' errors. Worth reading.
- Deletion tags
Do bear in mind that articles in the feed showing the trash can icon (you will need to have 'Nominated for deletion' enabled for this in your filters) may have been tagged by inexperienced or non NPR rights holders using Twinkle. They require your further verification.
- Paid editing
Please be sure to look for the tell-tale signs of undisclosed paid editing. Contact the creator if appropriate, and submit the issue to WP:COIN if necessary. WMF policy requires paid editors to connect to their adverts.
- Subject-specific notability guidelines' (SNG). Alternatives to deletion
- Reviewers are requested to familiarise themselves once more with notability guidelines for organisations and companies.
- Blank-and-Redirect is a solution anchored in policy. Please consider this alternative before PRODing or CSD. Note however, that users will often revert or usurp redirects to re-create deleted articles. Do regularly patrol the redirects in the feed.
- Not English
- A common issue: Pages not in English or poor, unattributed machine translations should not reside in main space even if they are stubs. Please ensure you are familiar with WP:NPPNE. Check in Google for the language and content, and if they do have potential, tag as required, then move to draft. Modify the text of the template as appropriate before sending it.
- Tools
Regular reviewers will appreciate the most recent enhancements to the New Pages Feed and features in the Curation tool, and there are still more to come. Due to the wealth of information now displayed by ORES, reviewers are strongly encouraged to use the system now rather than Twinkle; it will also correctly populate the logs.
Stub sorting, by SD0001: A new script is available for adding/removing stub tags. See User:SD0001/StubSorter.js, It features a simple HotCat-style dynamic search field. Many of the reviewers who are using it are finding it an improvement upon other available tools.
Assessment: The script at User:Evad37/rater makes the addition of Wikiproject templates extremely easy. New page creators rarely do this. Reviewers are not obliged to make these edits but they only take a few seconds. They can use the Curation message system to let the creator know what they have done.
DannyS712 bot III is now patrolling certain categories of uncontroversial redirects. Curious? Check out its patrol log.
Go here to remove your name if you wish to opt-out of future mailings.
MediaWiki message delivery (talk) 22:15, 11 September 2019 (UTC)
Woodman Point, Coogee & Munster
editI had a further look into the Woodman Point location and I'm still convinced it is in Coogee. I have reverted you and left my reasoning for the moves on the two articles talk page. I think, it might be the better location to discuss this, if you wish. Best regards, Calistemon (talk) 15:25, 17 September 2019 (UTC)
hi
edit@Dan arndt: Hi you reviewed recently https://en.m.wikipedia.org/wiki/Draft:Mashrafe_(music) and comment that sputnik music isn’t a professional. Spuntik is well renowned verified music site. And without spuntik music admin approval no album is visible to the site or they remove if non notable song or album added. For this spuntik music review are validated. Per WP:NSONG its notable. 1. Subject multiple verified news. 2. Where lyrict and subject of the song Mashrafe advertise or speak about the song. 3.there have a full article about the singer where he talk about this song. 4.there have reviewed in verified music site. I read Wikipedia guidelines and then create this article according to the guidelines. 64.59.88.3 (talk) 06:40, 17 September 2019 (UTC)
@Dan arndt: Can you explain me please 64.59.88.3 (talk) 19:31, 17 September 2019 (UTC)
Changed bare URLs; changed author to non-fiction author
edit{{helpme}} Dan,
Thanks for your advice and edits on Fellows' page. Could you let me know what you think of the changes I made?
AndrewNueberger (talk) 18:26, 13 September 2019 (UTC)AndrewNueberger
AndrewNuebergerAndrewNueberger (talk) 16:59, 10 September 2019 (UTC)
AndrewNueberger (talk) 15:38, 10 September 2019 (UTC) AndrewNueberger (talk) 19:03, 19 September 2019 (UTC)
Reminder: Community Insights Survey
editShare your experience in this survey
Hi Dan arndt/Archive 15,
A couple of weeks ago, we invited you to take the Community Insights Survey. It is the Wikimedia Foundation’s annual survey of our global communities. We want to learn how well we support your work on wiki. We are 10% towards our goal for participation. If you have not already taken the survey, you can help us reach our goal! Your voice matters to us.
Please take 15 to 25 minutes to give your feedback through this survey. It is available in various languages.
This survey is hosted by a third-party and governed by this privacy statement (in English).
Find more information about this project. Email us if you have any questions, or if you don't want to receive future messages about taking this survey.
Sincerely,
Hello Dan Arndt, I did resubmit my article (my own bio) that was rejected because it did not have external substantive mentions of the subject. I added these links but forgot to remove my own website. I am wondering if (with my website link removed) it now meets the criteria. Thank you very kindly for your help. Priscilla Long
Response to message posted on my talk page
editI did not remove other people's comments in Articles for deletion debates of Tharshan Thiyagarajah . "Please do not remove Articles for deletion notices from articles" didn't do that either. Hope you're well. Regards HarishMP. — Preceding unsigned comment added by HarishMP (talk • contribs) 17:44, 2 October 2019 (UTC)
Reminder: Community Insights Survey
editShare your experience in this survey
Hi Dan arndt/Archive 15,
There are only a few weeks left to take the Community Insights Survey! We are 30% towards our goal for participation. If you have not already taken the survey, you can help us reach our goal! With this poll, the Wikimedia Foundation gathers feedback on how well we support your work on wiki. It only takes 15-25 minutes to complete, and it has a direct impact on the support we provide.
Please take 15 to 25 minutes to give your feedback through this survey. It is available in various languages.
This survey is hosted by a third-party and governed by this privacy statement (in English).
Find more information about this project. Email us if you have any questions, or if you don't want to receive future messages about taking this survey.
Sincerely,
Priyani Wijesekera
editI noticed that you have PRODed Priyani Wijesekera citing notability issues. I created it for the Women in Red stub contest thinking that she would be notable due to her service as the Secretary General of Parliament of Sri Lanka. I kindly suggest you to reconsider your nomination and instead you could have nominated it for Afd. Thank you. Abishe (talk) 03:50, 11 October 2019 (UTC)
Mister Yellowman (reggae album)
editHi Dan, this is the first article I try to write, so please have patience with me.
You wrote: "requires significant coverage in multiple independent secondary sources. Discogs is not a reliable or acceptable reference, as it is user generated without any independent editorial oversight."
All the info I put on the article I got from the physical CD and its booklet. Please, could you tell me how should I indicate this in the references section?
The discogs links you mention are not meant to be references, but external links to the same subject. Should I remove them?
Thanks for any help you can provide.
Mystic-One (talk) 03:14, 11 October 2019 (UTC)
- Mystic-One, WP:NALBUM has a pretty detailed list of ways to demonstrate that an album is notable. The sources you have used to verify the information may not be problematic, but they do not show that the album was "notable" per our guidelines. In other words, what makes this album important? This is what you need independent, in-depth sources for. Primefac (talk) 16:36, 11 October 2019 (UTC)
Request for reviewing draft article
editHey Dan, Just noticed that you made some wise changes in the draft article 'Smita Naram' submitted by me. I am glad that you guided me and made the essential changes. Can you please review the article as it's been rewritten as per the previous suggestions given by the Wikipedia reviewers. Thanks and regards, RahulJ730 RahulJ730 (talk) 16:56, 13 October 2019 (UTC)
Don Spencer’s year of birth
editI think you reverted my edit by mistake - you see, Don Spencer, to my knowledge, has never specifically stated that he was born in 1937, not 1941. 220.240.76.1 (talk) 08:36, 17 October 2019 (UTC)
You declined this submission, right? Well, it's been published anyway. Thought you'd appreciate a heads-up.- Sumanuil 03:28, 18 October 2019 (UTC)
Rae Billing
editYou comment: "The content of this submission includes material that does not meet Wikipedia's minimum standard for inline citations. Please cite your sources using footnotes. For instructions on how to do this, please see Referencing for beginners. Thank you." But I am using footnotes, so I don't understand what you are saying. Broadcastinglive2 (talk) 19:27, 19 October 2019 (UTC)broadcastinglive2
Hello. This is about the page Gunning For Greatness
editI have seen many of these pages before on Wikipedia but they were published. Such as No Spin, Resilient (book), My Story (Michael Clarke Book) and World of Aviation, that I had all previously created in Yimingllewyn. Why does this not work out to meet the credibility guidelines? LlewynYiming (talk) 00:12, 20 October 2019 (UTC)
Draft:Suite and Sour (The Loud House)
edithttps://en.wikipedia.org/wiki/Draft:Suite_and_Sour_(The_Loud_House)
This article is about an episode about The Loud House.
https://en.wikipedia.org/wiki/Overnight_Success_(The_Loud_House)
Why this article is on Wikipedia and not this one ? — Preceding unsigned comment added by 196.119.217.203 (talk) 14:39, 25 October 2019 (UTC)
https://theloudhouse.fandom.com/wiki/Suite_and_Sour — Preceding unsigned comment added by 196.119.217.203 (talk) 14:45, 25 October 2019 (UTC)
Draft:Suite and Sour (The Loud House)
edithttps://en.wikipedia.org/wiki/Draft:Suite_and_Sour_(The_Loud_House)
Can you find reliable second sources for this draft please ? If you don't found, submit it. — Preceding unsigned comment added by 196.119.217.203 (talk) 21:21, 25 October 2019 (UTC)
Draft: Shadow (rock band)
editHi Dan, our knowledge of IMDB is that it is a reliable source; it necessarily does have independent editorial oversight. Here is the link to the proof of this on IMDB: https://help.imdb.com/article/contribution/filmography-credits/imdb-credit-eligibility-faq/GXMWNMB8LQCZYFH8?ref_=helpart_nav_10#
• “I worked on a film/episode/etc. Can I be listed in the database?
If you worked on a film, video, TV show, episode, or game that is already listed in the database and you received on-screen credit, you should be eligible to be listed on IMDb. If we list the title but your name or credit does not yet appear on its IMDb page, you are welcome to submit it for inclusion.
• What do you mean by "eligible"?
As stated above, the first and most important thing is to have received a credit on the title. There are a few additional requirements -- we normally only list people who were credited in the original version of a title. For films, this means we'll only list people credited in the initial original theatrical release; for TV titles, it means people credited when the show first aired. In other words, we will not list individuals who worked and/or are only credited in the home video version, in the DVD deleted scenes, or in any other subsequent version. Also, we do not list credits for foreign language versions of a film (dubbing, dialogue editing, translations etc.), with the exception of the US dub of non-English animation.
• I have worked on a film/show/episode that you do not list. What now?
We can only add credits to titles that are already in the database. If the title is not yet listed, you are welcome to submit it as a new entry and our editors, upon verification of its eligibility, will add it to the database. You can (and should) submit your credit on the show at the same time. A separate FAQ page for new title submissions can be found here.
• My credit should be there -- why doesn't it show?
The vast majority of credits are submitted by users and/or people connected with the production of a title. If your credit is not there, it probably just means nobody submitted it yet. You are more than welcome to submit it yourself. You do not have to wait for the producers or the director of the film to send it: just find the title in the database, click on the Edit page button at the bottom of that page and follow the on-screen instructions.
• My credit used to be listed but now it's gone! Why?
When a title is announced or in production and is added to the database, our editors will normally start accepting credits for it. These credits, as per the disclaimer on the page, are always subject to change and can be removed at any time. When the title is actually released (or about to be released) and credits are finalized by the production, our editors routinely compare our listing with the actual on-screen credits and delete any entries that cannot be verified or do not match. If you used to be listed on a title and your credit has disappeared, it means our editors could not verify its accuracy during one of these routine checks.
• But I was in the title! Put it back!
If you think your credit was removed by mistake, you are welcome to resubmit it. However, please note that our editors may not accept it unless it can be verified.
• I can prove that I worked on the title. Why won't you list my credit?
We try to list everyone who was credited on each title. "Credited" means that your name appears in the title's opening or end titles and therefore you received on-screen billing. If your name does not appear in the credits, please see our uncredited appearance guidelines. If you were not credited you can submit your entry and add (uncredited) in the Attributes field. Please be aware, however, that acceptance of these submission is entirely at our editors' discretion.
• My contract says that I'm entitled to a screen credit. Isn't that enough?
Our experience is that sometimes people do not receive on-screen billing, even when a credit is contractually mandated. This could be due to accidental omissions or subsequent contractual changes -- regardless of the reason and of any contractual stipulations, we aim to list credits as they appear on-screen.
• I worked on a title and I was credited! How do I prove that to you?
First, you should resubmit the update via the site. You can go back to your original update in your update history and edit it and re-send it. You should double check that the entry does fulfill our eligibility requirements and provide additional information for our editors. You can do so via the IMDb Get Satisfaction User Community Platform. When you click on the Edit page button at the bottom of the page for the person or film you are trying to update, scroll down to the bottom of the submission form and check the "Miscellaneous Comment" or "Miscellaneous Correction" options. Then, on the next page, select the appropriate option from the drop-down menu (e.g., if you are adding a comment for an acting credit, select "Actor" or "Actress"; if you are adding a comment regarding a screenwriting credit, select "Writer", etc.) and type your comment in the text field. Everything you enter here will be sent directly to the staff in charge of that section of data on the site (and will not show up on the site -- this is for internal communication only). If you want to provide additional information to help us accept your submission, this is the way to do it.
• How can I provide proof that my submission is valid?
Please keep in mind that we require verification of on-screen billing. In other words, we do not just want verification that you were involved in the making of a film -- we want evidence that your name appears in the main or end titles. Cast/crew call sheets, contracts, payment receipts, etc. are not evidence of on-screen billing. If you are able to prove that the credit does appear on screen (e.g., by providing a screener copy or a screen grab of the credits or similar materials), please contact us and we'll give you further instructions.
• I don't want to be bothered with this. I assure you that the data is correct and I demand that you take my word and accept it.
Sorry, nothing personal -- but if our staff has not allowed your submission the first time around, it means that they will need verification before they can accept it. Also please remember that all submissions are subject to our editorial approval -- while we do our best to be as comprehensive and exhaustive as possible, we reserve the right to reject or withdraw information at any time at our sole discretion.
• I deserved an on-screen credit, but I was left out by mistake. You should list me anyway, since I worked on/appeared in it.
We list credits as they appear on screen, regardless of what job was performed, so as to not involve IMDb in disputes over who deserved credits. If you did not receive an on-screen credit, you may be eligible for an (uncredited) credit (subject to editorial approval). See our uncredited guidelines for more details.
• If my credit is not eligible, then why do you list these other guys who performed the same job as I did and were not credited either?
It is entirely possible that their credits are ineligible too and that they should not be listed. If you notice inaccurate entries, please submit a correction/deletion (and provide an appropriate explanation in the required comment field) and our editors will rectify the inaccuracy.
• Tracking your Contribution.
You can now track the status of your Credit submission and if it has not been approved, we'll tell you the reason why. If you are using the mobile apps, mobile website or desktop website you can access this feature via the 'Track your contribution' button, which has been added to the submission email receipt. Additionally, if you are using the desktop website, you can also use the 'Track Contribution' button now found in your contribution history page.” BFI is the British Film Institute, BFI is a reliable source which has stringent oversight. If you consider IMDB to be user generated, the users still have to provide IMDb with multiple reliable sources, and the IMDB editors research this after which they approve or decline. In this case, shadow is credited in the feature film as the band as well as the individual members.
Here is the link to the BFI website which is listed in the citations: https://www.bfi.org.uk/films-tv-people/4ce2b74c621ea BFI is not user generated. There are two newspaper stories, one from the El Paso Times, both of which are independent although they are on the Cliff White’s website.
Thank you so much for your time. — Preceding unsigned comment added by CareKidney (talk • contribs) 00:20, 26 October 2019 (UTC)
Draft:Suite and Sour (The Loud House)
editI added the reception category. — Preceding unsigned comment added by 197.253.231.47 (talk) 18:59, 26 October 2019 (UTC)
It clearly is stated from reviews on google play, and i've seen the game on youtube, so it is been verified, no self research.LlewynYiming (talk) 23:17, 26 October 2019 (UTC)
Thanks for the review. Honestly, I'm having a little trouble finding some better, more reliable secondary resources. I don't know if you can help me, if that's what this is for, but it would be appreciated. https://en.wikipedia.org/wiki/Draft:FIRE_RABBIT!!
Hi, I have added sources to this draft. Can you approve it now? M4DU7 (talk) 20:48, 28 October 2019 (UTC)
A barnstar for you!
editThe Special Barnstar | |
Hi, I have seen your work. It is quite great.
But the part which is saddening is to see my article get declined. So let me request you to write an article for the same. Thanks. Susmitha Sakhamuri (talk) 09:24, 29 October 2019 (UTC) |
Disambiguation link notification for November 1
editAn automated process has detected that when you recently edited Majestic City, you added a link pointing to the disambiguation page Atrium (check to confirm | fix with Dab solver).
(Opt-out instructions.) --DPL bot (talk) 07:32, 1 November 2019 (UTC)
Australian swimmers
editHi. Your recent edits to Belinda Woosley and Christine Barnetson were all unsourced. Please supply reliable sources for everything you add. Thanks. Lugnuts Fire Walk with Me 13:01, 2 November 2019 (UTC)
New Page Review newsletter November 2019
editHello Dan arndt,
This newsletter comes a little earlier than usual because the backlog is rising again and the holidays are coming very soon.
- Getting the queue to 0
There are now 807 holders of the New Page Reviewer flag! Most of you requested the user right to be able to do something about the huge backlog but it's still roughly less than 10% doing 90% of the work. Now it's time for action.
Exactly one year ago there were 'only' 3,650 unreviewed articles, now we will soon be approaching 7,000 despite the growing number of requests for the NPR user right. If each reviewer soon does only 2 reviews a day over five days, the backlog will be down to zero and the daily input can then be processed by every reviewer doing only 1 review every 2 days - that's only a few minutes work on the bus on the way to the office or to class! Let's get this over and done with in time to relax for the holidays.
Want to join? Consider adding the NPP Pledge userbox.
Our next newsletter will announce the winners of some really cool awards.
- Coordinator
Admin Barkeep49 has been officially invested as NPP/NPR coordinator by a unanimous consensus of the community. This is a complex role and he will need all the help he can get from other experienced reviewers.
- This month's refresher course
Paid editing is still causing headaches for even our most experienced reviewers: This official Wikipedia article will be an eye-opener to anyone who joined Wikipedia or obtained the NPR right since 2015. See The Hallmarks to know exactly what to look for and take time to examine all the sources.
- Tools
- It is now possible to select new pages by date range. This was requested by reviewers who want to patrol from the middle of the list.
- It is now also possible for accredited reviewers to put any article back into the New Pages Feed for re-review. The link is under 'Tools' in the side bar.
- Reviewer Feedback
Would you like feedback on your reviews? Are you an experienced reviewer who can give feedback to other reviewers? If so there are two new feedback pilot programs. New Reviewer mentorship will match newer reviewers with an experienced reviewer with a new reviewer. The other program will be an occasional peer review cohort for moderate or experienced reviewers to give feedback to each other. The first cohort will launch November 13.
- Second set of eyes
- Not only are New Page Reviewers the guardians of quality of new articles, they are also in a position to ensure that pages are being correctly tagged for deletion and maintenance and that new authors are not being bitten. This is an important feature of your work, especially while some routine tagging for deletion can still be carried out by non NPR holders and inexperienced users. Read about it at the Monitoring the system section in the tutorial. If you come across such editors doing good work, don't hesitate to encourage them to apply for NPR.
- Do be sure to have our talk page on your watchlist. There are often items that require reviewers' special attention, such as to watch out for pages by known socks or disruptive editors, technical issues and new developments, and of course to provide advice for other reviewers.
- Arbitration Committee
The annual ArbCom election will be coming up soon. All eligible users will be invited to vote. While not directly concerned with NPR, Arbcom cases often lead back to notability and deletion issues and/or actions by holders of advanced user rights.
- Community Wish list
There is to be no wish list for WMF encyclopedias this year. We thank Community Tech for their hard work addressing our long list of requirements which somewhat overwhelmed them last year, and we look forward to a successful completion.
To opt-out of future mailings, you can remove yourself here
MediaWiki message delivery (talk) 08:33, 3 November 2019 (UTC)
This user has taken the pledge to review 2 new pages a day. Help us bring the queue to 0! |
Disambiguation link notification for November 8
editAn automated process has detected that when you recently edited Christine Barnetson, you added a link pointing to the disambiguation page Perth College (check to confirm | fix with Dab solver).
(Opt-out instructions.) --DPL bot (talk) 07:35, 8 November 2019 (UTC)
A barnstar for you!
editThe Copyeditor's Barnstar | |
Thanks for the work you did in articles such as Brandix, Martin Trust and Christ Church Warleigh, Dickoya. I apologise for my mistakes that I made in recent times and you mentioned about copyright issues in Christ Church Warleigh, Dickoya. I am extremely sorry about my misconduct when creating these articles. Abishe (talk) 16:06, 8 November 2019 (UTC) |
normally
editwould never touch another's user page in a scrillion seconds of edit time (sic), but it spoke to me of something that already exists :) JarrahTree 02:45, 11 November 2019 (UTC)
Record producer mix up
editPages: Mike Stone (record producer), Mike D. Stone, Clay Records, Clay Records discography, Mike "Clay" Stone
Your page identifies you as part of WikiProject:Record Labels, so hoping you can do something with this. Seems there were three Mike Stones who worked in record producing. One of them worked at Clay Records. Clay records has two unsourced articles which should probably be merged (someone tagged them with improperly formatted merge proposal templates) and then either sourced or AfD'd. In theory any mention of Mike Stone of clay records can just redirect to Clay records. Problem is, Mike "Clay" Stone was deleted as an implausible redirect to Mike Stone (record producer) (which doesn't seem correct). The delete means there are ~50 redlinks to Mike of clay which should really point to one of three pages, and I'm not sure the various editor(s) who originally linked them were linking the correct mike. Care to try to unravel it all? Hydromania (talk) 08:29, 11 November 2019 (UTC)
Hi Dan, Greetings. I am not an involved editor for the above page, but just to let you know that I have reverted your edit as WP:PROD can only nominated once and if it is removed, then it can not be replaced. Chose WP:AfD if you want or WP:R2, requesting to move to draft space. Best. CASSIOPEIA(talk) 05:07, 12 November 2019 (UTC)
ArbCom 2019 election voter message
editCould you please spare some time to review my drafts?
editI composed two articles on Wikipedia and I am in need of your assistance in checking out my drafts for proper corrections if needed. My drafts are
Draft:Trending Yoruba Names and Draft:Omotola Bello Barakat
Thank you, I do appreciate. Goldie19 (talk) 09:16, 22 November 2019 (UTC)
Thank You!
editHi Dan, Just a quick note to say thank you for the welcome message. Some very helpful tip I'm sure I will use. I'll get in touch (or message the help page) if/when any questions arise! Thanks again, ECDonaldson (talk) 23:28, 25 November 2019 (UTC)
Hello, and thank you for submitting this article to Wikipedia Asian Month. Unfortunately, its acceptance is put on hold for now as the second paragraph of the article appears to be the same as part of this link. Once the paragraph in question is revised, the article will be accepted. Thank you and happy editing. Narutolovehinata5 tccsdnew 00:38, 26 November 2019 (UTC)
- As the issue has been addressed, the article has now been accepted. Thanks for the quick response. Narutolovehinata5 tccsdnew 11:43, 26 November 2019 (UTC)
The article Valet Records has been proposed for deletion because of the following concern:
No indication that subject meets WP:NORG
While all constructive contributions to Wikipedia are appreciated, pages may be deleted for any of several reasons.
You may prevent the proposed deletion by removing the {{proposed deletion/dated}}
notice, but please explain why in your edit summary or on the article's talk page.
Please consider improving the page to address the issues raised. Removing {{proposed deletion/dated}}
will stop the proposed deletion process, but other deletion processes exist. In particular, the speedy deletion process can result in deletion without discussion, and articles for deletion allows discussion to reach consensus for deletion. Jmertel23 (talk) 02:25, 30 November 2019 (UTC)
- Topdownjimmy (talk · contribs)
Hi Dan. Thank you for your review. Regarding musician notability for Dymaxion: "Musicians or ensembles may be notable if they meet at least one of the following criteria." Dymaxion meets at least three:
- "Has been the subject of multiple, non-trivial, published works appearing in sources that are reliable, not self-published, and are independent of the musician or ensemble itself."
- Coverage citation is listed for Tiny Mix Tapes (an 18-year-old online-only music magazine with a Wikipedia page of its own and many other citations on Wikipedia) and Exclaim! (a long-running print magazine)
- "Has been placed in rotation nationally by a major radio or music television network."
- Dymaxion continues to be regularly played by WFMU, a major independent New Jersey-based radio station.
- "Has released two or more albums on ... one of the more important indie labels (i.e., an independent label with a history of more than a few years, and with a roster of performers, many of whom are independently notable)."
- Dymaxion has two releases on Duophonic Records, a label started by Stereolab (a very notable musical group) with releases from Pram, Broadcast, The High Llamas, and other very notable musical acts.
After a request at WT:MILHIST, I've given this article a pretty thorough going over, and expanded it with numerous additional references. I've got a few more to work through from my collection, but I wondered if you would reconsider the submission; alternatively, whether I can simply move it into mainspace myself (I'm not familiar with AfC protocols, as it isn't a method I use for writing articles.) Harrias talk 00:23, 11 December 2019 (UTC)
Draft space move to be reverted
editYou have moved Draft:Cincinnat–Louisville rivalry to Draft:Cincinnati-Louisville rivalry, but the IP user 85.238.91.41 has contested the move in Special:Diff/930392825, so I will revert the move. Please do not move the draft again. GeoffreyT2000 (talk) 15:07, 12 December 2019 (UTC)
Chinese words do exist in Wikipedia as a redirect. see Template:R from alternative language. ~~ CAPTAIN MEDUSAtalk 12:41, 19 December 2019 (UTC)
New Page Review newsletter December 2019
edit- Reviewer of the Year
This year's Reviewer of the Year is Rosguill. Having gotten the reviewer PERM in August 2018, they have been a regular reviewer of articles and redirects, been an active participant in the NPP community, and has been the driving force for the emerging NPP Source Guide that will help reviewers better evaluate sourcing and notability in many countries for which it has historically been difficult.
Special commendation again goes to Onel5969 who ends the year as one of our most prolific reviewers for the second consecutive year. Thanks also to Boleyn and JTtheOG who have been in the top 5 for the last two years as well.
Several newer editors have done a lot of work with CAPTAIN MEDUSA and DannyS712 (who has also written bots which have patrolled thousands of redirects) being new reviewers since this time last year.
Thanks to them and to everyone reading this who has participated in New Page Patrol this year.
Rank | Username | Num reviews | Log |
---|---|---|---|
1 | Rosguill (talk) | 47,395 | Patrol Page Curation |
2 | Onel5969 (talk) | 41,883 | Patrol Page Curation |
3 | JTtheOG (talk) | 11,493 | Patrol Page Curation |
4 | Arthistorian1977 (talk) | 5,562 | Patrol Page Curation |
5 | DannyS712 (talk) | 4,866 | Patrol Page Curation |
6 | CAPTAIN MEDUSA (talk) | 3,995 | Patrol Page Curation |
7 | DragonflySixtyseven (talk) | 3,812 | Patrol Page Curation |
8 | Boleyn (talk) | 3,655 | Patrol Page Curation |
9 | Ymblanter (talk) | 3,553 | Patrol Page Curation |
10 | Cwmhiraeth (talk) | 3,522 | Patrol Page Curation |
(The top 100 reviewers of the year can be found here)
- Redirect autopatrol
A recent Request for Comment on creating a new redirect autopatrol pseduo-permission was closed early. New Page Reviewers are now able to nominate editors who have an established track record creating uncontroversial redirects. At the individual discretion of any administrator or after 24 hours and a consensus of at least 3 New Page Reviewers an editor may be added to a list of users whose redirects will be patrolled automatically by DannyS712 bot III.
- Source Guide Discussion
Set to launch early in the new year is our first New Page Patrol Source Guide discussion. These discussions are designed to solicit input on sources in places and topic areas that might otherwise be harder for reviewers to evaluate. The hope is that this will allow us to improve the accuracy of our patrols for articles using these sources (and/or give us places to perform a WP:BEFORE prior to nominating for deletion). Please watch the New Page Patrol talk page for more information.
- This month's refresher course
While New Page Reviewers are an experienced set of editors, we all benefit from an occasional review. This month consider refreshing yourself on Wikipedia:Notability (geographic features). Also consider how we can take the time for quality in this area. For instance, sources to verify human settlements, which are presumed notable, can often be found in seconds. This lets us avoid the (ugly) 'Needs more refs' tag.
Delivered by MediaWiki message delivery (talk) at 16:10, 20 December 2019 (UTC)
Hi there, I'm HasteurBot. I just wanted to let you know that Draft:MAK (Manickam Athapa Kounder), a page you created, has not been edited in 5 months. The Articles for Creation space is not an indefinite storage location for content that is not appropriate for articlespace.
If your submission is not edited soon, it could be nominated for deletion. If you would like to attempt to save it, you will need to improve it.
You may request Userfication of the content if it meets requirements.
If the deletion has already occured, instructions on how you may be able to retrieve it are available at WP:REFUND/G13.
Thank you for your attention. HasteurBot (talk) 01:37, 27 December 2019 (UTC)
WAM 2019 Postcard
editDear Participants and Organizers,
Congratulations!
It's WAM's honor to have you all participated in Wikipedia Asian Month 2019, the fifth edition of WAM. Your achievements were fabulous, and all the articles you created make the world can know more about Asia in different languages! Here we, the WAM International team, would like to say thank you for your contribution also cheer for you that you are eligible for the postcard of Wikipedia Asian Month 2019. Please kindly fill the form, let the postcard can send to you asap!
Cheers!
Thank you and best regards,
Wikipedia Asian Month International Team --MediaWiki message delivery (talk) 08:16, 3 January 2020 (UTC)
Your rejection of “Don’t Shut Me Down”
editThe article for “Don’t Shut Me Down”, which you rejected, was a song about an upcoming song. It may not be able to show notability that way, but Wikipedia create articles for upcoming songs all the time, I’ve seen it. Also, ABBA are an extremely popular band, they are famous. If you go onto their page on Wikipedia, they have a page that shows their fame, and their fame is referenced. CheatCodes4ever (talk) 04:36, 5 January 2020 (UTC)
Hello, my question is regarding a recent reject and use of sources. I quoted from US government documents (memos and reports) and cited the source of the quotes. However, the article was rejected due to the inclusion of said quotes. My understanding, as reflected in the article "Copyright status of works by the federal government of the United States" is that government documents of this sort are able to be quoted. Is this correct, or am I misinterpreting policy/considerations? Thank you.
Thank you!
editThank you for taking the time to tell me my article wasn't good enough! I appreciate it a lot! It helps me to know someone gives a damn! Thanks for giving that damn!
Mr.ChanelNarwal2006 (talk) 17:30, 12 January 2020 (UTC) Mr.ChanelNarwal2006
Saad Anjum
editGood morning,
Could you please tell me what was wrong with my article Saad Nayyar Anjum so I can resolve it? Justin7891 (talk) 15:30, 13 January 2020 (UTC)
been in high places then?
editgood one on the gardens! JarrahTree 02:52, 18 January 2020 (UTC)
WAM 2019 Postcard
editDear Participants and Organizers,
Kindly remind you that we only collect the information for WAM postcard 31/01/2019 UTC 23:59. If you haven't filled the google form, please fill it asap. If you already completed the form, please stay tun, wait for the postcard and tracking emails.
Cheers!
Thank you and best regards,
Wikipedia Asian Month International Team 2020.01
MediaWiki message delivery (talk) 20:58, 20 January 2020 (UTC)
Disambiguation link notification for January 21
editAn automated process has detected that when you recently edited World Trade Center (Colombo), you added a link pointing to the disambiguation page Poise (check to confirm | fix with Dab solver).
(Opt-out instructions.) --DPL bot (talk) 08:29, 21 January 2020 (UTC)
- Manjultiwari (talk · contribs)
I added notable media sources to the draft that was earlier rejected, however, it has been rejected again. What can I do to get this article published? I have cited notable media links, along with, award details.
Manjul Riwari 12:55, 22 January 2020 (UTC)
age related issues
editta for that, the amnesia got mixed with an early whiff of the freo doctor and whoosh the s and z got hazed... JarrahTree 03:53, 23 January 2020 (UTC)
My submission
editCan you keep the draft still available, so I can modify it to comply with the Wikipedia rules?-DANO- (talk) 00:45, 24 January 2020 (UTC)
Where can I access it, so I don't have to start all anew?-DANO- (talk) 00:45, 24 January 2020 (UTC)
Your draft article, Draft:MAK (Manickam Athapa Kounder)
editHello, Dan arndt. It has been over six months since you last edited the Articles for Creation submission or Draft page you started, "MAK".
In accordance with our policy that Wikipedia is not for the indefinite hosting of material deemed unsuitable for the encyclopedia mainspace, the draft has been nominated for deletion. If you plan on working on it further, or editing it to address the issues raised if it was declined, simply and remove the {{db-afc}}
, {{db-draft}}
, or {{db-g13}}
code.
If your submission has already been deleted by the time you get there, and you wish to retrieve it, you can request its undeletion by following the instructions at this link. An administrator will, in most cases, restore the submission so you can continue to work on it.
Thank you for your submission to Wikipedia! JMHamo (talk) 18:04, 26 January 2020 (UTC)
Page mover granted
editHello, Dan arndt. Your account has been granted the "extendedmover" user right, either following a request for it or demonstrating familiarity with working with article names and moving pages. You are now able to rename pages without leaving behind a redirect, move subpages when moving the parent page(s), and move category pages.
Please take a moment to review Wikipedia:Page mover for more information on this user right, especially the criteria for moving pages without leaving redirect. Please remember to follow post-move cleanup procedures and make link corrections where necessary, including broken double-redirects when suppressredirect
is used. This can be done using Special:WhatLinksHere. It is also very important that no one else be allowed to access your account, so you should consider taking a few moments to secure your password. As with all user rights, be aware that if abused, or used in controversial ways without consensus, your page mover status can be revoked.
Useful links:
- Wikipedia:Requested moves
- Category:Articles to be moved, for article renaming requests awaiting action.
If you do not want the page mover right anymore, just let me know, and I'll remove it. Thank you, and happy editing! — Wug·a·po·des 20:59, 27 January 2020 (UTC)
Draft page declined
editHi Dan, you recently removed my draft page on Limeburners Creek National Park from my sandbox I believe. I understand that this is because that page already exists on Wikipedia which is true, as I created it. I am working on this page on my sandbox and am adding stuff to the wikipedia page as I go. Is it possible to have it restored? Thanks — Preceding unsigned comment added by Dyngo2868 (talk • contribs) 02:41, 30 January 2020 (UTC)
Orphaned non-free image File:Birdsoftokyo oneway.jpg
editThanks for uploading File:Birdsoftokyo oneway.jpg. The image description page currently specifies that the image is non-free and may only be used on Wikipedia under a claim of fair use. However, the image is currently not used in any articles on Wikipedia. If the image was previously in an article, please go to the article and see why it was removed. You may add it back if you think that that will be useful. However, please note that images for which a replacement could be created are not acceptable for use on Wikipedia (see our policy for non-free media).
Note that any non-free images not used in any articles will be deleted after seven days, as described in section F5 of the criteria for speedy deletion. Thank you. --B-bot (talk) 03:22, 9 February 2020 (UTC)
Removal of categories
editWhy did you make edits such as this? ―Justin (koavf)❤T☮C☺M☯ 00:56, 13 February 2020 (UTC)
New Page Reviewer newsletter February 2020
editHello Dan arndt,
- Source Guide Discussion
The first NPP source guide discussion is now underway. It covers a wide range of sources in Ghana with the goal of providing more guidance to reviewers about sources they might see when reviewing pages. Hopefully, new page reviewers will join others interested in reliable sources and those with expertise in these sources to make the discussion a success.
- Redirects
New to NPP? Looking to try something a little different? Consider patrolling some redirects. Redirects are relatively easy to review, can be found easily through the New Pages Feed. You can find more information about how to patrol redirects at WP:RPATROL.
- Discussions and Resources
- There is an ongoing discussion around changing notifications for new editors who attempt to write articles.
- A recent discussion of whether Michelin starred restraunts are notable was archived without closure.
- A resource page with links pertinent for reviewers was created this month.
- A proposal to increase the scope of G5 was withdrawn.
- Refresher
Geographic regions, areas and places generally do not need general notability guideline type sourcing. When evaluating whether an article meets this notability guideline please also consider whether it might actually be a form of WP:SPAM for a development project (e.g. PR for a large luxury residential development) and not actually covered by the guideline.
Six Month Queue Data: Today – 7095 Low – 4991 High – 7095
To opt-out of future mailings, please remove yourself here
16:08, 13 February 2020 (UTC)
Nadeeka Guruge
editWhy you keep undoing the last edit? what was the reason? did you check what has did in the last edit? he just removed internal links and put plain text in lower case! — Preceding unsigned comment added by Maduka Jayalath (talk • contribs) 05:54, 14 February 2020 (UTC)
Negating Creation of Template
editMr Arndt,
I have not understood why you have declined my proposal for a missing template.
Without wanting to be rude, the reasons advanced are puerile and baseless.
All I want is a simple template. I will put it up again in a concise form.
Moitraanak (talk) 14:43, 15 February 2020 (UTC)
Hello Mr. Dan arndt this is about Katupitiya Walauwa How may i include this article for Wikipedia? This Is a missing place in sri lankan walauwas. So i want to say i need your help for put this article for Wikipedia. Please.... Wishmithak (talk) 00:43, 7 December 2019 (UTC)
Draft
editHi. The author has added further refs to Draft:We Fight to Be Free, and it both seem in good shape and is timely because of the new mini-series featuring George Washington. Can you please take another look? Thanks. Randy Kryn (talk) 15:24, 17 February 2020 (UTC)
Helius (freedman) re-review
editHello Dan,
You have reviewed Draft:Helius_(freedman)
Helius was an important high official in the imperial court of Emperor Nero. He is mentioned in several sources (public domain citations).
Would you please review it again after additions.
Disambiguation link notification for February 25
editAn automated process has detected that when you recently edited Victoria Masonic Temple, you added a link pointing to the disambiguation page 51st Regiment (check to confirm | fix with Dab solver).
(Opt-out instructions.) --DPL bot (talk) 09:42, 25 February 2020 (UTC)
Not a Duplicate
editHello Dan,
My draft keeps getting marked as a duplicate of a draft from 2019 from a different user with the same subject but not the same material. I don't know why my draft keeps getting flagged as related to this draft. I tried changing the name but even after that my draft is still being marked as a duplicate of the draft from 2019. Is there anything you can do to help? I need to have this article live by tonight for a college project and the reason it keeps being denied is out of my control. Here's a link to my draft you reviewed and thank you for taking the time to read this. https://en.wikipedia.org/wiki/User:ART401wp/sandbox
ART401wp (talk) 02:53, 26 February 2020 (UTC)ART401wp
Draft: Dorothy ('Dot') Butler / Dorothy Butler (conservationist)11:49, 27 February 2020 (UTC)
editHi Dan, I noticed that you have changed the name of the draft page to Dorothy Butler (conservationist). I am sure there is a good reason (and I want to stick to the rules) but, as the person who wrote the article, I should let you know that the new page name is not a good choice. There are one and a half lines on Dot's conservation efforts and it is not really what she is remembered for. She could have been described better as 'Dorothy Butler (walker and climber)', or 'Dorothy Butler (adventurer)', but her conservation efforts are not really why she is important in history. Just letting you know, in case there is an opportunity to change it to something that suits you but is also more relevant.TrimmerinWiki (talk) 11:50, 27 February 2020 (UTC)
Stop slander
editStop slander and harassment! I'm adding my pictures because we are building an encyclopedia of professional quality and this IMO includes professional pictures too. I'm doing it without having received a single cent from WMF or any chapter. I'm sorry that you don't like it. --A.Savin (talk) 14:00, 27 February 2020 (UTC)
February 2020
editYour recent editing history at Galle Lighthouse shows that you are currently engaged in an edit war; that means that you are repeatedly changing content back to how you think it should be, when you have seen that other editors disagree. To resolve the content dispute, please do not revert or change the edits of others when you are reverted. Instead of reverting, please use the talk page to work toward making a version that represents consensus among editors. The best practice at this stage is to discuss, not edit-war. See the bold, revert, discuss cycle for how this is done. If discussions reach an impasse, you can then post a request for help at a relevant noticeboard or seek dispute resolution. In some cases, you may wish to request temporary page protection.
Being involved in an edit war can result in you being blocked from editing—especially if you violate the three-revert rule, which states that an editor must not perform more than three reverts on a single page within a 24-hour period. Undoing another editor's work—whether in whole or in part, whether involving the same or different material each time—counts as a revert. Also keep in mind that while violating the three-revert rule often leads to a block, you can still be blocked for edit warring—even if you don't violate the three-revert rule—should your behavior indicate that you intend to continue reverting repeatedly. stwalkerster (talk) 18:41, 27 February 2020 (UTC)
Recent image reversals
editHello Dan. Hope you are well. Just a quick note (sent from work) with regards to the recent image reversals on a number of articles. I'd like to voice out regarding this view. Even though it may seem like the user is uploading "their" images to many articles, it is still immensely helpful to Wikipedia as most of the replacements are clearly helpful (I have not checked all). As volunteers building an encyclopedia, our ultimate goal is to present topics with the best images/illustrations, be it all from a single photographer or from many. And just for the record, the particular uploader has also replaced some of "my" images as well, but that is perfectly fine as the replacements are clearly better. I've also noticed instances where the uploader has uploaded better images, only to be changed to another (3rd) image to avoid the uploader's file altogether. While that does not necessary go against a policy, it is makes the environment quite unwelcoming to new contributors. Happy editing! Rehman 09:46, 28 February 2020 (UTC)
Teahouse question
editHi Dan arndt. Just letting you know about WP:THQ#Dan arndt rejected my article as a courtesy. I've also asked about this at WT:FOOTY to see if there's any way the FC might meet WP:NTEAM. -- Marchjuly (talk) 04:37, 2 March 2020 (UTC)
- Nealmueller (talk · contribs)
Hi Dan, thanks for your help with Dolphin Club. I added references from books and magazines, including dedicated articles about the Dolphin Club from the New York Times, SF Chronicle, The Frisc, and other magazines. Also removed sentences without citations and any that appeared like advertisements. The neighboring club The Southend Rowing Club offers similar services to the public. Still pretty new to editing on Wikipedia, and would enjoy further tips from you. Have a great day.
Draft:Nat_West_Hole_Ilkeston
editCan I just point out that this has been in the town for over thirty years and has grown to become a notable attraction. It just happens that the news items were prompted by the surprising suspension of reviews by Tripadvisor. The hole is there to stay and I am currently checking if there are now model souvenirs to purchase with proceeds going towards homeless organisations. Please reconsider the rejection. Thanks — Preceding unsigned comment added by DavoGregorious (talk • contribs) 11:57, 5 March 2020 (UTC)
Dolphin Club new page
editHi Dan, are there any edits you suggest for the Dolphin Club? I want to learn how to make a table in wikipedia, and was thinking of making a table of the 23 boats, which would allow people to sort by longest, and lightest boats, which isn't available using the photo I uploaded. Is this useful? Nealmueller (talk) 02:40, 3 March 2020 (UTC)
- Update, I made the boat fleet table. I also learned from your other edits and made the numbers convertible into metric.Nealmueller (talk) 05:07, 3 March 2020 (UTC)
Hi Dan, since Nealmueller has COI, the article needs to be scrubbed for neutrality and promotional portions in its history section, especially the name drops and lifespans. The building locations are probably sourced fine. AngusWOOF (bark • sniff) 18:59, 5 March 2020 (UTC)
- Angus you already scrubbed name drop in caption, and in retrospect I'm glad you did that. The lifespans were added by Dan and have nothing to do with COI. As I'm sure you can see my interest in wiikipedia trascends my interest in this club––look at my other contributions since 2007.Nealmueller (talk) 19:20, 5 March 2020 (UTC)
- Himanshujii (talk · contribs)
How can i rewiew my Current Draft:Himanshu Patel or how can i publish my article Draft:Himanshu Patel
Jon Bielinski
editHi Dan – I drafted a new article about the boat builder at the Dolphin Club. Could I ask you to please take a look at let me know if you think he is notable? https://en.wikipedia.org/wiki/User:Nealmueller/sandbox Nealmueller (talk) 21:43, 7 March 2020 (UTC)
Help Move to Article
editHello there i saw you changed my article name to (Rapper) thank you so much can you help me review and move it to article? Draft:Fredokiss (rapper) your help will be appreciated thank you. Naija165 (talk) 18:44, 9 March 2020 (UTC)
About the article 8
editI have no idea how all of Billie’s songs that were not singles charted in the USA and other countries, but 8 did very well around the world. I also think the non singles were just downloads and not cds. Beatleswillneverdie (talk) 01:47, 14 March 2020 (UTC)
Sorry, I meant digital download.. Beatleswillneverdie (talk) 01:49, 14 March 2020 (UTC)
Hambantota
editHi Dan arndt, I don't understand why you reverted my edits. 1) The original statement (by a previous editor) was an example of understandable but poor English usage. I fixed that. 2) The point that many public projects are examples of governments extracting money from their populaces at gunpoint to fund ostensibly worthwhile projects that those citizens won't voluntarily fund because they are not worthwhile but that enable the officials to signal virtue, buy votes, and facilitate corruption, is a worthwhile point. What it needs is a citation to who the critics are, not suppression of the controversy. Regards, Acad Ronin (talk) 17:15, 19 March 2020 (UTC)
- Fangtengbo (talk · contribs)
Please elaborate in more detail about the mistakes in the article.
Please point to some examples.
Can you please provide some detailed step by step instructions to improve my article ?
Significant media mentions in reliable source
editHey there, recently you have reviewed my article "Drip Creationz" can you please let me know why it got rejected? The company has been significantly covered by reliable sources such asYahoo News, International Business Times, The Statesman, Mid Day etc.
it's pass both WP:NCOMPANY, WP:CORPDEPTH
link of the article: https://en.wikipedia.org/wiki/User:Meme_Lord_519/sandbox Meme Lord 519 (talk) 10:31, 28 March 2020 (UTC)
Draft:Terrell Grobes
editHey man what should i change in my article ? — Preceding unsigned comment added by JosephTM1 (talk • contribs) 08:21, 30 March 2020 (UTC)
Draft :Suresh Sharma
editThere are two The Hindu article which has one one paragraph each about kadam tree writ filed by suresh sharma. Secondly 3 and 4 references are not available online so i have given citation for them . And both article says Rajasthan High court prohibited the cutting of kadam in the state of Rajasthan on the writ filed by Suresh Sharma. Alekh99 (talk) 09:26, 31 March 2020 (UTC)
Please reply as this is the third time the reviewer has declined Alekh99 (talk) 09:27, 31 March 2020 (UTC)
The Thiyyar Regiment of British Indian Army
editNo it's not like members of thiyya community has enrolled in british indian army, there were a seperate regiment. Why don't you refer to the reference given , look the news paper where it says 'Thiyyar promised to form a regiment in 1904 amoung them ' , look the letter written to governor of madras state wich says 'why did thiyyar regiment being disbanded ?' .Also refer to the book North africa to north malabar , which clearly says 'there were a thiyyar regiment centered at thalassery' . These references are enough to prove the historical importance of thiyyar regiment centered at british indian army under Madras state. — Preceding unsigned comment added by Othayoth shankaran (talk • contribs) 04:51, 1 April 2020 (UTC)
I need your opinion on this article. It shows considerable CoI problems, see Authorship.
The top four editors each have a probable link to the subject:
- The top account is an editor, who previously claimed to be Southbank Records (one of the artist's labels). It recreated the article in April 2018.
- While the 2nd, with a similar user name, edits in a similar manner.
- The 3rd one claims to be the artist. That account created the article back in late 2016, which was speedily deleted in December 2016.
- While the 4th is a SPA with 7 edits in three days of similar content to the previous account.
The article uses BadCharts for recordings.
Other than iTunes for singles/an EP, it provides poor sources for the content.
The artist worked as Saccas for about 10 years, mostly djing in Kalgorilie and Perth. He formed Beyond tha Noize as a duo with Tom Dodd but later continued the performance name as a solo concern. Relocted to Southbank, Melbourne. Article claims the artist toured internationally.
It needs a lot of work but is it worth it?shaidar cuebiyar (talk) 11:24, 1 April 2020 (UTC)
- Thanks for the good cheer: have one on me! As for BTN, your clarification about DJing removes one of my doubts about deletion: go for it.shaidar cuebiyar (talk) 05:41, 2 April 2020 (UTC)
Your submission at Articles for creation: Scutellaria multiglandulosa has been accepted
editCongratulations, and thank you for helping expand the scope of Wikipedia! We hope you will continue making quality contributions.
The article has been assessed as Stub-Class, which is recorded on its talk page. It is commonplace for new articles to start out as stubs and then attain higher grades as they develop over time. You may like to take a look at the grading scheme to see how you can improve the article.
If you have any questions, you are welcome to ask at the help desk. Once you have made at least 10 edits and had an account for at least four days, you will have the option to create articles yourself without posting a request to Articles for creation.
If you would like to help us improve this process, please consider
.Thanks again, and happy editing!
Dan arndt (talk) 02:28, 3 April 2020 (UTC)Article for submission
editHello, I have created two articles, please review.
171.79.177.134 (talk) 10:31, 3 April 2020 (UTC)
Please review these articles Mr Tejal (talk) 11:54, 3 April 2020 (UTC)
Submitted the article for review
editHi, I have corrected two articles and made submissions, please review.
Draft:Bhamatsar Draft:Sumit Godara Mr Tejal (talk) 05:53, 4 April 2020 (UTC)
Please these articles Draft:Sumit Godara Mr Tejal (talk) 07:56, 4 April 2020 (UTC)
Hello. I added the PROD tag on the image File:TLO-TLO.jpg, which you uploaded. If the tag is left uncontested for more than seven days, the image would be deleted. --George Ho (talk) 04:28, 5 April 2020 (UTC)
Article for submission
editHi,
I have improved the Draft:Sumit Godara article, please review Mr Tejal (talk) 05:46, 5 April 2020 (UTC)
Declined Article
editHello Dan, I hope you're doing great! Sorry for bothering you but I would really appreciate your guidance in this matter. My "Lebanese record labels" article does not have a lot of references online, because it is still not so popular or talked about, however, all of the information that I have stated in this article are valid and honest: I have contacted and gathered information from 3 producers, A&Rs, people in the music industry and most importantly I have lived all my life in Lebanon so I have some knowledge on what goes on in the music scene in Lebanon. I would appreciate your help on how I can fix this. Moreover, I will re-edit my article to make it more Wikipedia worthy and not an essay for college... Also, I wrote this article from a neutral point of view, if you can let me know exactly where you think I wrote something from a personal point of view. I can't thank you enough for reading my article in the first place, Hope to hear from you soon RowanneMusic (talk) 23:06, 5 April 2020 (UTC)RowanneMusic
Hi there, please delete Clarence Valley Orchestra & Chorus page I submitted today - we're obviously not that important. (musicmanforlife)
Request a Article
editHi, I have applied for creating Amit Bhadana article on Wikipedia:Requested articles/Arts and entertainment/Film, radio and television page, please see and contribute to make Amit Bhadana article. Thank you Mr Tejal (talk) 11:44, 6 April 2020 (UTC)
THANK YOU
editThank you soooo much Dan for helping me out!!! This is super helpful, I'll be fixing my article and adding it to Music in Lebanon Thank you again, I really appreciate it, I'll definitely ask you if I have any other questions, All the best RowanneMusic (talk) 15:27, 6 April 2020 (UTC)RowanneMusic
I mean Music of Lebanon lol — Preceding unsigned comment added by RowanneMusic (talk • contribs) 15:29, 6 April 2020 (UTC)
Article for submission
editHi, I have just written the article Draft:Girdharilal Mahiya, please review. Mr Tejal (talk) 03:22, 7 April 2020 (UTC)
Updating my references or external links
editWhat type of references or external links do i need to have my page published? I have seen many athletes with wikipedia pages and they are not of note or have not played for any teams professionally. I also have an interest in creating this page because of the number of other people of note with the same name I feel that this person deserves a page to avoid confusion and have recognition for those looking for him
This link provides plenty of online, print and other media sources covering his career and games
https://www.google.com/search?q=larry+williams+aubenas+france&oq=larry+williams+aubenas+france&aqs=chrome..69i57.15672j0j7&sourceid=chrome&ie=UTF-8 — Preceding unsigned comment added by Basketballfan2009 (talk • contribs) 03:27, 7 April 2020 (UTC)
Notability
editMy original question I guess is why are there so many other profiles of players who don't meet the requirements of notability but they have pages. I don't understand the discrepancy. Also what sort of references would be suitable? Finishing 4th in the world on Team Doha in the 2016 FIBA 3x3 All stars. He also competed in the Arab Club Basketball Championship with ASE in 2014 and the Hobart Chargers were in the SEABL which was the 2nd best league in Australia at the time. He won a championship in the Moroccan top league and played in the top Lebanese league which features multiple NBA players. He was a main contributor on 2 separate TBT teams that advanced past the first round. Various news media outlets covering his signing to different teams and game coverage.
Again one of the main factors for wanting to create his page is the number of similarly named people and another person being a completely different basketball player who is a streetballer and not him
This is not a page to brag but to give information about a player that I do (especially in comparison to other pages I have visited) believe is notable. — Preceding unsigned comment added by Basketballfan2009 (talk • contribs) 19:20, 7 April 2020 (UTC)
Draft review
editHello, I have deleted second draft moved all information to first draft please review our Draft:Ilham_Nagiyev . Thanks in advance! MrTaghizade (talk) 22:45, 7 April 2020 (UTC)
Resubmission
editLike you said, I have removed some incorrect information from the Amit Bhadana article. Please review. And when I get more information, I will add more jaw. Till then accept this article Draft:Amit Bhadana (youtuber) Mr Tejal (talk) 04:22, 8 April 2020 (UTC)
WAMI 2006
edit- Did "Px7" win a WAMI? see here
- Too many sources are self-published, interviews or non-substantial coverage of the subject.
- Metal Forge also has a review of 2nd EP, here
- FasterLouder gig review is too short, see here
- Are there enough RSes to sustain claim to MUSICBIO?shaidar cuebiyar (talk) 12:36, 9 April 2020 (UTC)
- Fangtengbo (talk · contribs)
Fangtengbo (talk) 22:14, 9 April 2020 (UTC)
Thank you for your recommendations. I will try to re-write the whole thing.
WAM 2019 Postcard: All postcards are postponed due to the postal system shut down
editDear all participants and organizers,
Since the outbreak of COVID-19, all the postcards are postponed due to the shut down of the postal system all over the world. Hope all the postcards can arrive as soon as the postal system return and please take good care.
Best regards,
Wikipedia Asian Month International Team 2020.03 User:MediaWiki message delivery (talk) 01:51, 26 March 2020 (UTC)
What is good faith edit?
editHi Dan arndt What is good faith edit? User:Sachith Dilshan Kaluwitharana (talk) 15:46, 13 April 2020 (UTC)
Hey just a heads up, I saw your comment on this article that I just approved. Didn't want it to seem I was superseding your request for further explanation as to why the subject is notable enough to be listed on NRHP. As much as you or I (particularly I) don't like it, AfD has pretty much held all listings on the NRHP are notable (even though there's over a million of them). So unfortunately the SOP is to publish these barebones stub articles. Cheers Sulfurboy (talk) 03:38, 14 April 2020 (UTC)
The Barnstar of Diligence
editThe Barnstar of Diligence | |
Awarded to Dan Arndt for his enormous and valued contributions Sachith Dilshan Kaluwitharana (talk) 11:26, 15 April 2020 (UTC) |
- 71.43.86.34 (talk · contribs)
Hi Dan,
My name is Roosevelt Pacheco and I am the one that created this Article on Steven Lassalle. It's hard for me to understand why the rejection on this Article. Since, Wikipedia is loaded with similar profiles. Lassalle is a raising fashion stylist that has made many contributions and connections with TV Personalities, Models, Actors, R&B, Rappers and Hip Hop Arties. I think is notable to point him out so that people know more about him.
Considering that this is my first article on Wikipedia, please let me know how I can make this work.
Thank you and appreciate your help moving forward.
Roosevelt Pacheco
A barnstar for you!
editThe Original Barnstar | |
Thank you Dan, you are appreciated Classymango (talk) 16:38, 16 April 2020 (UTC) |
Disambiguation link notification for April 17
editAn automated process has detected that when you recently edited Home from the Sea (film), you added a link pointing to the disambiguation page Seminal (check to confirm | fix with Dab solver).
(Opt-out instructions.) --DPL bot (talk) 14:29, 17 April 2020 (UTC)
Garthpool (barque)
editMany thanks, Dan, for your work and further research on the Gsrthpool page. Next up, the British sailing ship Rotomahana. Cheers! .Chiefsub68 (talk) 14:55, 21 April 2020 (UTC)
S. C. Obeysekara Jnr
editI am not sure if S. C. Obeysekara Jnr and Solomon Christoffel Obeyesekere are in fact the same person. Some references refer to a S. C. Obeysekara in the legislative council in 1915, this could be Solomon Christoffel Obeyesekere, although he was knighted in 1911. Cossde (talk) 07:28, 21 April 2020 (UTC)
- Agreed, would make sense to delete. Cossde (talk) 14:08, 21 April 2020 (UTC)
- Thanks. Cossde (talk) 04:55, 22 April 2020 (UTC)
Draft:WA Limestone Group
editHi Dan arndt, I appreciate your contribution to Wikipedia greatly, and was simply enquiring as to why my article is still being denied, even though each statement presented in the wikipedia page has references which are reputable, I would appreciate your opinion on this :) — Preceding unsigned comment added by Danieldellabona (talk • contribs) 00:25, 23 April 2020 (UTC)
Bridges
editWhat do we call a bridge that has arch & the deck is passing through arch? M.M 08:09, 23 April 2020 (UTC) — Preceding unsigned comment added by Mybelline (talk • contribs)
Mtentu bridge
editThank you Dan arndt for your contribution on Mtentu bridge article much appreciated! M.M 08:11, 23 April 2020 (UTC) — Preceding unsigned comment added by Mybelline (talk • contribs)
Hello there. This is an invitation to join the 50,000 Destubbing Challenge Focus of the Week. £250 (c. $310) is being given away in May, June and July with £20 worth of prizes to give away every week for most articles destubbed. Each week there is a different region of focus, including one week dedicated to South-South East Asia, though half the prize will still be rewarded for articles on any subject. There's a potential £120 to be won in total for destubbing on any subject or region of your choice. Sign up if you want to contribute at least one of the weeks or support the idea! † Encyclopædius 11:40, 28 April 2020 (UTC)
bruhkowski
editHow is Poofesure's verified twitter not a valid source to make an article about him? and my second source was not YouTube, it was YouTube Wiki. — Preceding unsigned comment added by Nolanisntfunny (talk • contribs) 18:39, 29 April 2020 (UTC)
Wikiprojects|yaoweh
editDear Dan, iam excited over your immediate review of any subject submitted. Iam thrill at your hardworking; your immediate responses and active review made me feel happy. Iam glad that you review my submissiom and give me a marks of excellence to continue adding other lags of the paragraphs; i appreciate your good works.
Thank yaoweh Yaoweh (talk) 07:36, 5 May 2020 (UTC)
Question About My Article
editGood Day Dan,
Hope you are well. I am new to Wikipedia and put a lot of work into my article about Loy Ghazi Mir Zaman Khan Kunari. The first time I submitted it, you said it read more like an essay, which was very helpful feedback.
I have since edited the piece, but see a declined date of April 15, 2020, but at the bottom I see it is still under review. Is there an action item needed from my end?
I apologize for my novice. — Preceding unsigned comment added by FDGCI (talk • contribs) 22:11, 12 May 2020 (UTC)
A barnstar for you!
editThe Special Barnstar | |
For you excellent work on Sri Lanka, keep up the great work! † Encyclopædius 11:53, 13 May 2020 (UTC) |
Dambagalla is that the same place as Madulla? Can you check? I'm also not sure the tea estate is the same place, the district in the citation seemed ot be more central. I thought it would starting though!† Encyclopædius 12:55, 13 May 2020 (UTC)
Notagallery
editSee WP:NOTAGALLERY you refer to: "Photographs or media files with no accompanying text". This is obviously not applying for these galleries, so just STOP playing your games. --A.Savin (talk) 12:23, 13 May 2020 (UTC)
- A.Savin - The premise of WP:NOTAGALLERY is that Wikipedia is an encyclopedia, and articles should not be a collection of images, each image should illustrate specific facets of the article and relate to the description in that article, they should not simply be a repetition of images already present. I am simply trying to ensure that irrelevant images are removed, wherever possible. If there are multiple images they should be linked to Wikicommons. Dan arndt (talk) 09:15, 18 May 2020 (UTC)
Dan: thank you for taking your time to edit submissions. I respect that it is no easy task.
I submitted a reference and three paragraphs to the beginning to the entry on Ice Segregation. The current entry on Ice Segregation relates only to the subsurface form of Ice Segregation. My submission was to extend the reach of the process of Ice Segregation.
On the Wikipedia page for Needle Ice it states that Needle Ice forms by the process of Ice Segregation. Needle Ice occurs at the surface and thus the discussion on the existing Ice Segregation page does not relate to Needle Ice.
Ice Segregation is the process producing Frost/Ice Flowers on plant stems as well as Hair Ice. Sometime those pages need to be upgraded to reflect the current science.
As a start to upgrade our knowledge about the natural formation of ice at the surface I thought it was best to integrate the article by Ozawa and Kinosita into the entry on Ice Segregation, the subject of their paper.
Thank you for considering my comments.
I see you live in Perth. Been there decades ago. Lovely, but I suspect you do not see much ice. Maybe black swans.
James R Carter (talk) 19:13, 19 May 2020 (UTC) James R. CarterJames R Carter (talk) 19:13, 19 May 2020 (UTC)
FYI, I added a ton to that article and moved it to article space. Not sure what the protocol at AFC is (never interacted with it) but, since you had declined it earlier, I should let you know. Don't want to step on any toes! --regentspark (comment) 22:07, 20 May 2020 (UTC)
Question About My Article
editHi Dan - I hope I am submitting this correctly! Thanks for taking the time to look over my submission for Dezron Douglas. You said it didn't warrant a page, but my subject actually already has a German page [[3]] and I wasn't sure how to translate/make it available in English, as he is an American musician and active mostly in the states. Is there any help that you can provide? In the meantime, I can add some sources to the page as your suggested. Thank you for your time! Eastmeer (talk) 15:27, 21 May 2020 (UTC)Brandee Younger
HMS Leander Image
editHi - thanks for moving HMS Leander (1848) to mainspace. You removed my failed image insertion - could you please fix the insertion of the image which is really on wikicommons [[4]], even though
fails. Weirdly, it works in "preview page".
Newystats (talk) 06:30, 22 May 2020 (UTC)
- OK - sorted now. Newystats (talk) 06:14, 23 May 2020 (UTC)
I've rejected the draft this time. Robert McClenon (talk) 22:15, 25 May 2020 (UTC)
Orphaned non-free image File:Panics House Street Town.jpg
editThanks for uploading File:Panics House Street Town.jpg. The image description page currently specifies that the image is non-free and may only be used on Wikipedia under a claim of fair use. However, the image is currently not used in any articles on Wikipedia. If the image was previously in an article, please go to the article and see why it was removed. You may add it back if you think that that will be useful. However, please note that images for which a replacement could be created are not acceptable for use on Wikipedia (see our policy for non-free media).
Note that any non-free images not used in any articles will be deleted after seven days, as described in section F5 of the criteria for speedy deletion. Thank you. --B-bot (talk) 03:55, 27 May 2020 (UTC)
Orphaned non-free image File:Panics-kyad.jpg
editThanks for uploading File:Panics-kyad.jpg. The image description page currently specifies that the image is non-free and may only be used on Wikipedia under a claim of fair use. However, the image is currently not used in any articles on Wikipedia. If the image was previously in an article, please go to the article and see why it was removed. You may add it back if you think that that will be useful. However, please note that images for which a replacement could be created are not acceptable for use on Wikipedia (see our policy for non-free media).
Note that any non-free images not used in any articles will be deleted after seven days, as described in section F5 of the criteria for speedy deletion. Thank you. --B-bot (talk) 03:56, 27 May 2020 (UTC)
Decline for Flats Boat
editHi, I saw the decline reason was for duplicate of Flat-bottomed boat. Flats boats are not necessarily flat bottomed, in fact most designs are not. They are a category/design of modern boats and while some do have flat bottoms those are typically created by only a few manufacturers and referred to as skiffs. They aren't the same thing. If anything, the existing article may touch on a few designs of flats boats which are flat bottomed a subcategory of flats boats by modern convention although some such as barges etc are absolutely not relevant as "flats boats" How would you suggest proceeding? Mlepisto (talk) 04:46, 27 May 2020 (UTC)
It's just a link to another new page. There you have references.
Thanks for making it a redirect and accepting. I added information about the file suffix to the MidiNameDocument page.
Articles for Creation: List of reviewers by subject notice
editHi Dan arndt, you are receiving this notice because you are listed as an active Articles for Creation reviewer.
Recently a list of reviewers by area of expertise was created. This notice is being sent out to alert you to the existence of that list, and to encourage you to add your name to it. If you or other reviewers come across articles in the queue where an acceptance/decline hinges on specialist knowledge, this list should serve to facilitate contact with a fellow reviewer.
To end on a positive note, the backlog has dropped below 1,500, so thanks for all of the hard work some of you have been putting into the AfC process!
Sent to all Articles for Creation reviewers as a one-time notice. To opt-out of all massmessage mailings, you may add Category:Wikipedians who opt out of message delivery to your user talk page. Regards, Sam-2727 (talk)Dolphin Club (San Francisco) COI tag removal
editI saw you removed the COI tag there. Are you okay now with calling it neutral? Can you update the connected contributor tag on the talk page? AngusWOOF (bark • sniff) 23:56, 1 June 2020 (UTC)
My new page on Ullas Trust
editThank you for pointing out the issues on the page I'd created: I will rewrite those sections so that they don't violate any copyright issues. Apologies and appreciate your guidance. Regards.Mohitoz (talk) 11:19, 3 June 2020 (UTC)
Thank You
editThank you for taking the time and effort to review my page! — Preceding unsigned comment added by Ooh Saad (talk • contribs) 13:55, 4 June 2020 (UTC)
Sherman Booth Page
editThank you for taking the time to provide feedback on my entry regarding the Sherman booth house. I've made the updates you suggested. SMBooth (talk) 04:52, 6 June 2020 (UTC)
Rollback
editHi - I just closed the ANI thread, but then noticed your comment I'm also of the opinion that A.Savin is equally guilty of abusing the rollback tool even if he’ll never admit.
I don't know exactly what you are referring to there, but I just wanted to point out that A.Savin does not have the rollback permission, and so is not technically capable of misusing it; so I expect that's a misunderstanding unless I'm missing something significant.
I am not here to weigh in on the question of whether or not the edits were improvements, or your reverts appropriate; I just want to be clear that if you are reverting for any other reason than obvious outright vandalism, you should not use the rollback tool, and should give an edit summary. I don't know whether you use Twinkle? That's what I use for that kind of stuff - the green or blue 'rollback' options allow you to leave an edit summary, and are otherwise just as convenient as a proper Rollback, without all the baggage that goes along with the WP:ROLLBACK guidelines. Anyway, I thank you for indicating that you'll be more careful in future, and present you with this fishy friend.
Plip!
GirthSummit (blether) 17:57, 8 June 2020 (UTC)
OMG I've been trout slapped !!! Dan arndt (talk) 02:31, 9 June 2020 (UTC)
Hi, just to let you know that as per WP:COMMONNAME I have moved the page back to its original place. Eumat114 formerly TLOM (Message) 10:35, 9 June 2020 (UTC)
Ask for help Article: Kamvas studio 22
editDear Dan arndt, My reference is coming from a reliable news website, which is well-known in China. I am confused that it cannot be accepted. Please help and let me know how can I do for it. Thank you very much. Reference: https://news.163.com/20/0520/17/FD3CKOUE00019OH3.html — Preceding unsigned comment added by Cytheriachen (talk • contribs) 10:37, 10 June 2020 (UTC)
Speedy deletion nomination of Draft:CK Kumaravel
editIf this is the first article that you have created, you may want to read the guide to writing your first article.
You may want to consider using the Article Wizard to help you create articles.
A tag has been placed on Draft:CK Kumaravel, requesting that it be speedily deleted from Wikipedia. This has been done under section G11 of the criteria for speedy deletion, because the page seems to be unambiguous advertising which only promotes a company, group, product, service, person, or point of view and would need to be fundamentally rewritten in order to become encyclopedic. Please read the guidelines on spam and Wikipedia:FAQ/Organizations for more information.
If you think this page should not be deleted for this reason, you may contest the nomination by visiting the page and clicking the button labelled "Contest this speedy deletion". This will give you the opportunity to explain why you believe the page should not be deleted. However, be aware that once a page is tagged for speedy deletion, it may be deleted without delay. Please do not remove the speedy deletion tag from the page yourself, but do not hesitate to add information in line with Wikipedia's policies and guidelines. If the page is deleted, and you wish to retrieve the deleted material for future reference or improvement, then please contact the deleting administrator. Cahk (talk) 08:53, 11 June 2020 (UTC)
Wikipedia article publication issue
editDear sir Dan arndt, I am a PhD candidate of Louisiana state university and i have decided to publish wikipedia page who attended or passed from this university and right now considered as a notable. You informed me to create the article about "nuski baby" with an encyclopediac tone and remove references related with factmandu,youtube,facebook,instagram etc. I will also add secondery references beyond with this. Regina Lambero is waiting to see her wiki page on google eagerly and she gave me a photo of her with copyright permissions. I hope I will be able to publish the article and it will be visible on search engine after those corrections have been done.
Thank you. I'm waiting to hear from you if i can add references 1.birthwiki.com/nuski-baby 2.go.google.com/nuski-baby 3.biography.com
Regards -arefin Arefin sazzad (talk) 01:25, 12 June 2020 (UTC)
Support
editSir, How to earn a Buracratic level Louise340 (talk) 08:16, 13 June 2020 (UTC)
Your draft article, Draft:Dr Anchayil Reghu
editHello, Dan arndt. It has been over six months since you last edited the Articles for Creation submission or Draft page you started, "Dr Anchayil Reghu".
In accordance with our policy that Wikipedia is not for the indefinite hosting of material deemed unsuitable for the encyclopedia mainspace, the draft has been nominated for deletion. If you plan on working on it further, or editing it to address the issues raised if it was declined, simply and remove the {{db-afc}}
, {{db-draft}}
, or {{db-g13}}
code.
If your submission has already been deleted by the time you get there, and you wish to retrieve it, you can request its undeletion by following the instructions at this link. An administrator will, in most cases, restore the submission so you can continue to work on it.
Thank you for your submission to Wikipedia! JMHamo (talk) 21:24, 13 June 2020 (UTC)
June 2020
editHello, I'm A.Savin. I wanted to let you know that one or more of your recent contributions have been undone because they did not appear constructive. If you would like to experiment, please use the sandbox. If you have any questions, you can ask for assistance at the Teahouse. Thanks. A.Savin (talk) 13:38, 2 June 2020 (UTC)
This is repeated case where you abused your Rollbacker flag for edit-warring. Next time I will report it at Admin's board and request removal of the flag. Thanks --A.Savin (talk) 13:40, 2 June 2020 (UTC)
- Not certain what exactly you are talking about. Unlike you I’m not going to delete comments on my talk page because I don’t agree with what people say. Dan arndt (talk) 14:19, 2 June 2020 (UTC)
- If you fail to understand = not my problem. Here are both recent difflinks with your Rollback abuse: [5], [6]. --A.Savin (talk) 14:42, 2 June 2020 (UTC)
- I think you’ll find that I provided my explanation on the article’s talk page, which is the appropriate forum to have that sort of discussion. Also I don’t take kindly to your belligerent threats. Dan arndt (talk) 14:56, 2 June 2020 (UTC)
- There is a very, very simple solution for all that: Just leave me alone and let me do my job. Same goes to your buddy Obi2canibe. --A.Savin (talk) 15:16, 2 June 2020 (UTC)
- I’m sorry and your job is what exactly? Dan arndt (talk) 15:22, 2 June 2020 (UTC)
- Improvement of articles. --A.Savin (talk) 16:55, 2 June 2020 (UTC)
- That's surprising, given your edit history, I would have assumed that it was trying to shoe horn as many of your photos into existing articles as possible that and ignoring the opinions of other editors as to the worthiness of those images but I guess I was wrong. Dan arndt (talk) 02:32, 3 June 2020 (UTC)
- Assuming good faith is not your strength, I guess. --A.Savin (talk) 13:05, 3 June 2020 (UTC)
- Actually it is one of my strengths - if you check my edit history. Dan arndt (talk) 04:09, 4 June 2020 (UTC)
- Why then am I exempted? --A.Savin (talk) 09:26, 4 June 2020 (UTC)
- Well if you re-check, you'll see that I did take your initial edits in good faith. But in some circumstances we are clearly in disagreement about what constitutes the most appropriate image in some articles. I understand that you have a dogmatic view that it is about the quality of the image as opposed to having an image that actually depicts what the article is about. Dan arndt (talk) 01:10, 5 June 2020 (UTC)
- It would be nice if you responded to the actual question -- accusing someone "to shoe horn as many of your photos" surely has nothing to do with AGF. --A.Savin (talk) 02:07, 5 June 2020 (UTC)
- I don't believe I accused you of anything, I may have assumed but never accused (there is a difference). Dan arndt (talk) 05:12, 5 June 2020 (UTC)
- OK, so why assumed? Please? --A.Savin (talk) 13:22, 5 June 2020 (UTC)
- Probably based on a perceived degree of arrogance shown in your edits, due to a lack of explanation provided when you are replacing images. As I previously stated it is not always the quality of the image that is important it is what the image depicts and how it demonstrates/reflects what the article is about. Dan arndt (talk) 00:11, 7 June 2020 (UTC)
- You please show me a policy that makes an explanation of every replacement of a picture in an article mandatory. Thanks! --A.Savin (talk) 00:44, 7 June 2020 (UTC)
- Oh, and wrt to arrogancy better do not "throw stones from a glass house". --A.Savin (talk) 00:46, 7 June 2020 (UTC)
- Probably based on a perceived degree of arrogance shown in your edits, due to a lack of explanation provided when you are replacing images. As I previously stated it is not always the quality of the image that is important it is what the image depicts and how it demonstrates/reflects what the article is about. Dan arndt (talk) 00:11, 7 June 2020 (UTC)
- OK, so why assumed? Please? --A.Savin (talk) 13:22, 5 June 2020 (UTC)
- I don't believe I accused you of anything, I may have assumed but never accused (there is a difference). Dan arndt (talk) 05:12, 5 June 2020 (UTC)
- It would be nice if you responded to the actual question -- accusing someone "to shoe horn as many of your photos" surely has nothing to do with AGF. --A.Savin (talk) 02:07, 5 June 2020 (UTC)
- Well if you re-check, you'll see that I did take your initial edits in good faith. But in some circumstances we are clearly in disagreement about what constitutes the most appropriate image in some articles. I understand that you have a dogmatic view that it is about the quality of the image as opposed to having an image that actually depicts what the article is about. Dan arndt (talk) 01:10, 5 June 2020 (UTC)
- Why then am I exempted? --A.Savin (talk) 09:26, 4 June 2020 (UTC)
- Actually it is one of my strengths - if you check my edit history. Dan arndt (talk) 04:09, 4 June 2020 (UTC)
- Assuming good faith is not your strength, I guess. --A.Savin (talk) 13:05, 3 June 2020 (UTC)
- That's surprising, given your edit history, I would have assumed that it was trying to shoe horn as many of your photos into existing articles as possible that and ignoring the opinions of other editors as to the worthiness of those images but I guess I was wrong. Dan arndt (talk) 02:32, 3 June 2020 (UTC)
- Improvement of articles. --A.Savin (talk) 16:55, 2 June 2020 (UTC)
- I’m sorry and your job is what exactly? Dan arndt (talk) 15:22, 2 June 2020 (UTC)
- There is a very, very simple solution for all that: Just leave me alone and let me do my job. Same goes to your buddy Obi2canibe. --A.Savin (talk) 15:16, 2 June 2020 (UTC)
- I think you’ll find that I provided my explanation on the article’s talk page, which is the appropriate forum to have that sort of discussion. Also I don’t take kindly to your belligerent threats. Dan arndt (talk) 14:56, 2 June 2020 (UTC)
- If you fail to understand = not my problem. Here are both recent difflinks with your Rollback abuse: [5], [6]. --A.Savin (talk) 14:42, 2 June 2020 (UTC)
- Seriously you were the one that asked the question about assumptions and then you attack the response. Maybe you should chill out and relax.Dan arndt (talk) 01:34, 7 June 2020 (UTC)
- Yeah, I asked this question... and still got no answer from you. So, once again: Why are you not assuming good faith wrt to my work? Why do you think that my only goal is kind of shoe-horning or whatever may it mean. Can't you imagine, that someone is taking pictures, carefully upload and georef and categorizing in order to improve the quality of the contents? Can I have an explanation, please? Thanks. --A.Savin (talk) 01:50, 7 June 2020 (UTC)
- I feel that we are going around and around in circles. I have answered all your questions both here and the various other talk pages that you’ve raised them. You obviously either aren’t prepared to listen/understand the answers or you are ignoring them. Either way that’s up to you. I’ll repeat myself again in an effort to make you understand both my rationale and what others have stated. It is not about your images but the need for the images to reflect/reinforce aspects of the articles. Simply placing good quality images and in some cases multiple images of the same subject doesn’t always enhance the article and often detracts which is what some of your edits do. Dan arndt (talk) 02:31, 7 June 2020 (UTC)
- Yeah, I asked this question... and still got no answer from you. So, once again: Why are you not assuming good faith wrt to my work? Why do you think that my only goal is kind of shoe-horning or whatever may it mean. Can't you imagine, that someone is taking pictures, carefully upload and georef and categorizing in order to improve the quality of the contents? Can I have an explanation, please? Thanks. --A.Savin (talk) 01:50, 7 June 2020 (UTC)
I'm happy to repeat my question again and again, because there is still no response from you: Why can't you just let it be and stop harassing me? I have been on Wiki projects since 15 years, and nearly always I get a positive feedback on my photographic work. So this cannot be true that all my pictures are overprocessed, non-representative, of poor quality or whatever. You and Obi2canibe just have a problem with me that none of you is willing to disclose. You and Obi2canibe have nothing to do with professional photography. And I spend my time, money (not few of that!) in Wiki projects because I wish their contentual quality to be raised. I have no commercial interest, if you think sth like that to yourself. People on Commons, whose photographic work I know and respect, never would treat me as hostile and unfair as you+Obi do. I am a human and may occasionally make mistakes, yes. But I don't believe that I make them systematically, as your attitude towards me clearly suggests. I just don't believe you both anymore. I don't want to see you as kind of an editorial or censorship department which is monitoring all my edits and decides for each, what comes in and what not. It is against the spirit of Wiki movement. I am not willing to accept this hostile behaviour. You have to look for a sysop of your trust to block me. Otherwise I will continue, because I really don't see that my contribution to Wikipedia is destructive in any way. My net-contribution is clearly positive, as it is on Commons. --A.Savin (talk) 22:15, 13 June 2020 (UTC)
- Any response? --A.Savin (talk) 02:55, 14 June 2020 (UTC)
The following was originally posted on User talk:A.Savin however A.Savin chose to move it here, potentially to avoid having other fellow editors view it and the issues it has identified about his ongoing behaviour
I am going to provide you with a response here so that other editors can read it, although if you choose to delete it (as you have in the past) then that is your choice. Firstly I am not targeting you or your edits. Some of your recent edits have been made on articles that are on my Watchlist, which is why they have come to my attention. Despite your beliefs I have not been stalking you - simply I have a lot better things to do with my time. Secondly there are a number of edits that you have made (images added) to Sri Lankan articles that I think enhance the article for which I have thanked you for your edits. Thirdly I think that you should pay more attention to the advice of others, not necessarily myself, who have repeatedly advised you to be WP:CIVIL, observe WP:BRD and WP:3RR. I have attempted to discuss my concerns on the various articles' talkpages and allow others to participate in those discussions - which you seem to have used as an opportunity to attack any other editors who have a different opinion to yours. Finally as I have repeatedly advised you the main issue I have with a number of your images is that they do not reflect what that intent of the article actually is. They may be good quality images but that does not necessarily mean that they best represent what the articles are about. Also by adding multiple images of the same subject actually detracts from the article. The main emphasis is on the content (i.e. describing what the article is about) Wikipedia is not an image repository. I hope that this clarifies and answers your queries. Dan arndt (talk) 11:36, 14 June 2020 (UTC)
- No, I don't feel like this answers my question, because, as stated, it is definitely not normal if two same users are permanently monitoring my edits and reverting most of them, despite the fact that I am acting in good faith, to the best of my knowledge and belief, and otherwise nearly all people find my work constructive. It cannot be that my pictures are inappropriate by default. Some few may be, but definitely not 70-80% of them, as your and Obi's hostile behaviour towards me suggest. All the discussions where I had to defend myself, by now in the uttermost cases had only three participants: me, you, and Obi. I don't believe that you and/or Obi are the main authors of all these articles, or have them all on watchlist by coincidence. But even if you are the only author, the article is not your private property. --A.Savin (talk) 13:11, 14 June 2020 (UTC)
- I'm sorry if the truth isn't the answer that you were after. At the risk of repeating myself, yet again, I am not permanently monitoring your edits nor am I reverting all of them. It's unfortunate if that does fit your paranoia but as I said earlier I have better things to do with my time then stalking you. Also as I have previously stated I don't speak for Obi2canibe - he is his own person and it is not for me to explain his actions but I would assume that he like me has better things to do than to follow your edit history. I certainly don't believe I have demonstrated any aspect of 'ownership' of any article, whether I created it or not but I guess that doesn't fit your personal theories or paranoia.Dan arndt (talk) 13:44, 14 June 2020 (UTC)
Edit warring noticeboard
editG'day Dan. In your ANI report of A.Savin, I notice that you mentioned "has previously been advised on a ANI that 'ask that in future if you are reverted, you go directly to the talk page rather than reinstating'". If this is the case, then there are many examples of it not being followed. Could you please post a link of where this was advised? Cheers, 1292simon (talk) 10:21, 14 June 2020 (UTC)
- There is currently a discussion at Wikipedia:Administrators' noticeboard/Incidents regarding an issue with which you may have been involved. --A.Savin (talk) 14:00, 14 June 2020 (UTC)
- Unfounded allegations - responded to. Dan arndt (talk) 14:06, 14 June 2020 (UTC)
remind me
editwhen we meet, the jokes about the absurdity of it all... JarrahTree 14:12, 14 June 2020 (UTC)
- JarrahTree time consuming but ultimately a waste of time & effort. 14:14, 14 June 2020 (UTC)
- ahah the nub is the number of active eds from oz at this time of night is so slim, its like lockdown at the local pub. you can even here the sparrows fart over the otherside of the road outside of the pub, or similar metaphors. The big test is when there are issues to be dealt with - in the old days there was always a friendly name show up on the watchlist and things could be resolved - now these days they dont even ever respond to emails... sigh, its a differentplace JarrahTree 14:19, 14 June 2020 (UTC)
- We are well overdue for that beer. Can swap cold war stories and you know I’ll respond to your emails (eventually). Dan arndt (talk) 14:36, 14 June 2020 (UTC)
- well I always like asserting here - as I write there are in fact 2 oz sysops who I have had things to do with in real life, whom I like, and I am sure every statement I assert, there is always a heisebergian paradox that shows me the opposite as I say it... JarrahTree 14:40, 14 June 2020 (UTC)
- We are well overdue for that beer. Can swap cold war stories and you know I’ll respond to your emails (eventually). Dan arndt (talk) 14:36, 14 June 2020 (UTC)
Hoping to settle the image dispute
editPlease see User talk:A.Savin#Complaint about your edits of Central Province, Sri Lanka. I hope you will respond there and offer your thoughts on a long-term solution of your image dispute with User:A.Savin. Thanks, EdJohnston (talk) 15:09, 16 June 2020 (UTC)
My submission at Articles for creation
editI know that the subject already exists on wikipedia, but MineCon mostly focuses on the conventions instead of the livestreams. Which is why i wanted to make a separate article on the livestreams, similar to Minecraft Festival which was also covered in MineCon but has it's own article because it is separate from the regular MineCon conventions. MineCon Live is also separate from the regular MineCon conventions. Which is why I wanted to make an article on it. the ultraUsurper (talk) 07:13, 17 June 2020 (UTC)
New Page Reviewer newsletter June 2020
editHello Dan arndt,
- Your help can make a difference
NPP Sorting can be a great way to find pages needing new page patrolling that match your strengths and interests. Using ORES, it divides articles into topics such as Literature or Chemistry and on Geography. Take a look and see if you can find time to patrol a couple pages a day. With over 10,000 pages in the queue, the highest it's been since ACPERM, your help could really make a difference.
- Google Adds New Languages to Google Translate
In late February, Google added 5 new languages to Google Translate: Kinyarwanda, Odia (Oriya), Tatar, Turkmen and Uyghur. This expands our ability to find and evaluate sources in those languages.
- Discussions and Resources
- A discussion on handling new article creation by paid editors is ongoing at the Village Pump.
- Also at the Village Pump is a discussion about limiting participation at Articles for Deletion discussion.
- A proposed new speedy deletion criteria for certain kinds of redirects ended with no consensus.
- Also ending with no change was a proposal to change how we handle certain kinds of vector images.
Six Month Queue Data: Today – 10271 Low – 4991 High – 10271
To opt-out of future mailings, please remove yourself here
Provide additional supporting sources for Kamvas studio 22
editHi Dan arndt,
Thank you very much for your responding. I provide additional supporting sources as following.
- https://www.sogi.com.tw/talks/%E7%B9%AA%E7%8E%8B%E4%B8%80%E9%AB%94%E6%A9%9FKamvas_studio_22%E7%99%BC%E4%BD%88_%E7%A7%91%E6%8A%80%E6%84%9F%E5%8D%81%E8%B6%B3_%E9%81%A9%E7%94%A8%E5%A4%9A%E5%A0%B4%E6%99%AF/6265474
- http://www.cnarts.net/cweb/news/read.asp?id=453284&kind=%D2%D5%CA%F5
- https://penxilstudios.com/huion-kamvas-studio-22/
- https://www.huanbao-world.com/others/167665.html
- http://forum.tabletpcreview.com/threads/huion-kamvas-studio-22-all-in-one-computer.75431/
- https://huiontablet.tumblr.com/post/617869125093572608/kamvas-studio-22?is_related_post=1
- https://mytabletguide.com/huion-kamvas-studio-22-specs-features-and-overview/
Please help me to review it again.Thank you very much
Hi Dan arndt, Thank you very much for your response. I had added them into draft, please help me to review it again. Thanks.
Hello Dan arndt, Thank you for your advice. The specifications is the most important part that people need to learn about this article. Do you really think I need to remove it ? Or maybe I need to change a way to introduce specifications rather than a table? I really appreciate your help and guide.
Hello Dan arndt, Thank you for your guide. I revised the article. Please help me to review if it is ok. Thank you very much.
Dear Dan arndt, Thank you very much. I appreciate your guidance. — Preceding unsigned comment added by Cytheriachen (talk • contribs) 09:57, 18 June 2020 (UTC)
Partners Relief & Development ampersand
editHello Dan Arndt,
Thank you for your input on my draft for Partners Relief & Development. I don't know if it was you or a Wikipedia formatting bug, but the page title and some of the mentions in the article draft were changed from "Partners Relief & Development" to "Partners Relief and Development. The charity is actually registered with an ampersand as is their website and social media. I edited the mentions in the body text of the article back to ampersands, but I cannot edit the page title. I would prefer the article to use the correct name of the charity. Is this something you have control over? Thanks, Sir Barnaby (talk) 03:37, 19 June 2020 (UTC)
Digital Postcards and Certifications
editDear Participants and Organizers,
Because of the COVID19 pandemic, there are a lot of countries’ international postal systems not reopened yet. We would like to send all the participants digital postcards and digital certifications for organizers to your email account in the upcoming weeks. For the paper ones, we will track the latest status of the international postal systems of all the countries and hope the postcards and certifications can be delivered to your mailboxes as soon as possible.
Take good care and wish you all the best.
This message was sent by Wikipedia Asian Month International Team via MediaWiki message delivery (talk) 18:58, 20 June 2020 (UTC)
Hi there! I would appreciate your imput on my FLC named above, but feel free to disregard in case you're too busy. I hope you have a wonderful weekend! Greets; Cartoon network freak (talk) 06:55, 21 June 2020 (UTC)
Ask for Help to review draft: Huion
editHello Dan arndt, There is no existing another submission Huion. I clicked it, which appeared words "Wikipedia does not have a page with this exact title." I hope you can consider my submission and review it again, please. I make it more complete according to Wikipedia criteria. Thank you very much. — Preceding unsigned comment added by Sachi1307 (talk • contribs) 10:44, 19 June 2020 (UTC)
Dan arndt, Could you help review my submission? — Preceding unsigned comment added by Sachi1307 (talk • contribs) 09:39, 22 June 2020 (UTC)
Hello Dan,
Thank you very much for reviewing the draft, I am General manager of the brand DALOOD. We want very much to publish our brand history on wikipedia, all the information we uploaded are our own and we have all the copyrights for it, please let me know how should we proceed? Your help will be very much appreciated, Giorgi
What are the requirements
editHey please suggest me what has to be corrected in this article Bewithstartup (talk) 02:43, 1 July 2020 (UTC)
Thanks for the help with Rødovre Skøjte Arena
editAEJ (talk) 06:09, 1 July 2020 (UTC) Any suggestion that the Mark Saver II web page is a duplicate is a lie! They are in fact two seperate enries, one for each version of Mark Saber, as I believve both versions of Mark Sabre are seperate characters and that was my intention from the beginning!Glammazon (talk) 10:58, 1 July 2020 (UTC)
MfD nomination of Draft:JIMMY SHARMA
editDraft:JIMMY SHARMA, a page which you created or substantially contributed to, has been nominated for deletion. Your opinions on the matter are welcome; you may participate in the discussion by adding your comments at Wikipedia:Miscellany for deletion/Draft:JIMMY SHARMA and please be sure to sign your comments with four tildes (~~~~). You are free to edit the content of Draft:JIMMY SHARMA during the discussion but should not remove the miscellany for deletion template from the top of the page; such a removal will not end the deletion discussion. Thank you. Curb Safe Charmer (talk) 15:12, 1 July 2020 (UTC)
Asking for Help with Draft:Kurt Kerns
editHello! I am the creator and editor of the Draft:Kurt Kerns that you reviewed earlier. I compiled more reliable, secondary sources (there are around twenty, now) about the subject in addition to fixing all the incorrect citation formatting. You commented that the subject did not seem to have had any noteworthy commissions, so I added more details about the major projects and clients he has worked with based on information from various articles online. I have re-submitted the draft for review, and I would love for you to re-review and give me feedback on the page. Any assistance would be appreciated, thank you! Calvin Foss (talk) 02:21, 2 July 2020 (UTC)
Thank you
editThanks for reviewing the Troutman Pepper draft article. I added a ton of third-party cites as you suggested and re-submitted. I'm not great at wikipedia so appreciate the review.
Sri Charan Pakala
editplease help review creation of the page. Singharaju (talk) 01:52, 4 July 2020 (UTC)
AfC Submission Inquiry
editHi! I saw your comment on my submission for a Wikipedia page on Juliana Schroeder. Since there's an existing draft for the individual already, what would you suggest that I do with my content? Is there still a chance my draft will be published as a Wikipedia page even if another draft exists elsewhere? Thanks! A&W100 (talk) 06:35, 7 July 2020 (UTC)
Speedy deletion nomination of Choi Jong-deok
editA tag has been placed on Choi Jong-deok requesting that it be speedily deleted from Wikipedia. This has been done under section R2 of the criteria for speedy deletion, because it is a redirect from the article namespace to a different namespace except the Category, Template, Wikipedia, Help, or Portal namespaces.
If you think this page should not be deleted for this reason, you may contest the nomination by visiting the page and clicking the button labelled "Contest this speedy deletion". This will give you the opportunity to explain why you believe the page should not be deleted. However, be aware that once a page is tagged for speedy deletion, it may be deleted without delay. Please do not remove the speedy deletion tag from the page yourself, but do not hesitate to add information in line with Wikipedia's policies and guidelines. DannyS712 (talk) 12:44, 7 July 2020 (UTC)
Speedy deletion nomination of Kim Sin-yeol
editA tag has been placed on Kim Sin-yeol requesting that it be speedily deleted from Wikipedia. This has been done under section R2 of the criteria for speedy deletion, because it is a redirect from the article namespace to a different namespace except the Category, Template, Wikipedia, Help, or Portal namespaces.
If you think this page should not be deleted for this reason, you may contest the nomination by visiting the page and clicking the button labelled "Contest this speedy deletion". This will give you the opportunity to explain why you believe the page should not be deleted. However, be aware that once a page is tagged for speedy deletion, it may be deleted without delay. Please do not remove the speedy deletion tag from the page yourself, but do not hesitate to add information in line with Wikipedia's policies and guidelines. DannyS712 (talk) 12:47, 7 July 2020 (UTC)
Hi Dan,
I am trying to get the wiki page up for my highly respected friend and doctor at Johns Hopkins Center for Health Security, Dr. Amesh Adalja. As you probably saw, he is one of the major medical contributors in mainstream media regarding infectious disease and has been working non-stop since COVD-19 broke out. I asked him if there was anything I could do to help him while he is out there trying to inject some sanity during this crazy event, and he asked if I could create a wiki page and help him update his own website (trackingzebra.com, which I have lately been remiss in updating....). Much of the biographical information I have and what others have been given, is directly from him. I don't want to change the information because they are facts about him and all relevant for a wiki page. He, of course, is very consistent in what he provides everyone. Therefore, there is significant overlap regarding these biographical details in many different sources. This was my first ever wiki page. However, this is the second time I have submitted a page for him. The first time, I just took what he had (with his permission of course) on trackingzebra.com and updated it somewhat. I submitted it under a wiki id that I created for him. It was rejected both for copyright and for appearing to be submitted by him directly. So after reading the requirements more closely, I created my own wiki ID and spent significant time writing more information about Dr. Adalja's views on the handling of the COVID-19 epidemic in addition to including this biographical information. At this point, I am at a loss of what to do to get this page published. By definition, it needs to contain these biographical facts. Can you please provide some more guidance so I can complete this page accepted? I'll post it again in my sandbox in case you cannot retrieve the one that seems to have been deleted.
Thank you,
Kathryn Daley
kathryn@thriveupfdn.org
AFc Submission 16 July 2020
editHi Dan! This is RMAerospace Can you please review my article again? — Preceding unsigned comment added by RMAerospace (talk • contribs) 09:16, 16 July 2020 (UTC)
Suggestion
edit- Can you create it please? for actor and tour guide. you can see it in google and news links. and Elcinema.com, and IMDb.
- in Google
- in Series Napoleon wal Mahrousa. (ar) News
- is tour guide. alwafd.news
- Thank you. — Preceding unsigned comment added by 197.48.204.50 (talk) 14:57, 16 July 2020 (UTC)
A cheeseburger for you!
editNom. Nom. Charlotte Crosby (talk) 07:41, 21 July 2020 (UTC) |
"Draft:HIV Epidemic among MSM in Azerbaijan" listed at Redirects for discussion
editA discussion is taking place to address the redirect Draft:HIV Epidemic among MSM in Azerbaijan. The discussion will occur at Wikipedia:Redirects for discussion/Log/2020 July 23#Draft:HIV Epidemic among MSM in Azerbaijan until a consensus is reached, and anyone, including you, is welcome to contribute to the discussion. UnitedStatesian (talk) 21:23, 23 July 2020 (UTC)
Michelle Dilhara article
editHi. as you know, Michelle Dilhara article has tagged with speedy deletion due to several paraphrasing and other non-encyclopedic stuff. However, I changed it and remodeled the article by removing all unwanted parts. So I think, that speedy deletion tag should be removed from that article. What are yourthoughts...?? Thank You... Gihan Jayaweera (talk) 10.58, 23 July 2020 (UTC)
Hello Dan Arndt,
Thanks for your article on G. gunatillekeorum. Being a newly described species, it is not in Plants of the World Online, World Checklist of Selected Plant Families, The Plant List or only of the other lists listed here (under Accepted names). In spite of that, I think it's okay to include an article about it, but I've removed it from the list at Gastrodia, and linked to it from the bottom of that page. I'm hoping G. gunatillekeorum will soon be included in those lists. Gderrin (talk) 05:13, 29 July 2020 (UTC)
- Sorry! I have clearly directed this to the wrong person! Gderrin (talk) 06:01, 29 July 2020 (UTC)
Draft: Waco Fire Department
editI need your help in reviewing my article. No others will even consider it due to your flag of copyright materials, which is disagreed with, but that really isn't my concern or a big deal. You flagged the article for an image, and that image has been removed, but even though that has been resolved no one wants to even consider it. I'm just asking you to look at it since you were the first to check it. Thanks for your help, just looking to get this cleared up. 1836Texas~Republic1846 (talk) 16:24, 29 July 2020 (UTC)
Draft:Rekha Krishnappa
editHi! Can you move this article? Eswnav (talk) 03:29, 31 July 2020 (UTC)
Disambiguation link notification for August 2
editAn automated process has detected that when you recently edited Gamperaliya (novel), you added a link pointing to the disambiguation page Kaliyugaya.
(Opt-out instructions.) --DPL bot (talk) 06:39, 2 August 2020 (UTC)
Hi. I am somewhat confused that a draft article on an album release (One Three Seven) is being rejected on the grounds that the album is not notable. Has the reviewer spent any time looking at the other wikipedia articles related to the band that released the album? Given that these comprise a fairly comprehensive page for the band and individual pages for every one of their albums (with the exception of the one I am trying to create) I believe that question of notability has already been answered as far as wikipedia is concerned. I see no issue in filling in a missing gap for an album that may not be particularly notable in and of itself but which is part of a career that is already quite comprehensively documented in wikipedia. Thanks for your time.
Go1845 (talk) 04:04, 4 August 2020 (UTC)
Request on 09:33:58, 4 August 2020 for assistance on AfC submission by 2405:6E00:1E52:4600:951F:B236:23A:2D4
edit
I give up. I didn't expect to encounter the response I have. I guess there must be a storage space issue for wikipedia if this is par for the course. I am even more disappointed to see that my activities have jeopardised the existence of several other pages. As a financial supporter of wikipedia I have to say that this exercise has left a sour taste in my moth. Thank you for your time.
2405:6E00:1E52:4600:951F:B236:23A:2D4 (talk) 09:33, 4 August 2020 (UTC)
Bevis Bawa
editI have added additional information regarding Bawa on the Talk page of that listing, for your reference — Preceding unsigned comment added by Michael773623 (talk • contribs) 07:00, 4 August 2020 (UTC)
Thanks for your prompt response, I still believe the original text should stand, Bawa's sexuality is only relevant to provide context to The Brief's design. I have added two extra Citations to substantiate this text. Michael773623 (talk) 10:57, 4 August 2020 (UTC)
- Content Star (talk · contribs)
Yes, earlier u reviewed my article here on Wikipedia of which it wasn't fit for Wikipedia, however, I have made some reasonable edits and changes to this article, and would love you to review it again.
Guadalupe bewick's wren
editHello! I thank you for accepting my two articles on cockatoos and I have one more for you. Draft:Guadalupe Bewick's wren. Regards, Vihaking277 (talk) 14:27, 6 August 2020 (UTC)
An invitation for you!
edit- Invitation to WikiProject Birds
Apologies, I am new to Wiki
This article is an event that will occur next month and is already linked on the main calendar page here https://en.wikipedia.org/wiki/2020_MotoGP_season 2020 MotoGP season
I am merely trying to remove this dead-link with a placeholder as exists for all the other races in the World Championship. MotoGP is the top level category for any type of motorcycle racing, equivalent of F1. Not sure how this requires justification, thanks!
Asking
editDraft:Carol Eve Rossen is already existing article at https://es.wikipedia.org/wiki/Carol_Eve_Rossen i try it for english wikipedia is that wrong--VETTI PAIYAN-(talk) 08:29, 19 August 2020 (UTC)
Submission rejected on 19 August 2020 by Dan arndt
editHello Dan, You did not give me much of a reason for your rejection. However, I rewrote it and was wondering if you would take another look and let me know how I am doing? I would like to try for inclusion into the Kitchen Chapter Thank you for your time Juergen (LLC28146 (talk) 10:24, 19 August 2020 (UTC))
Mate from Pirth it explicitly and verifiably quote used by the University of Kansas and distro kids as well as the TBI research on how the material has been collected and archived for the public and has been released to the world under a suitably-free and compatible copyright license and is public domain and written in an acceptable tone.
If you believe it would read better as an editor - I will rework the information, for readability and communication we kept the material close to the artists approved statement.
lets speak soon when you have a chance and hammer this out Casetrick (talk) 12:14, 19 August 2020 (UTC)
Page move
editBut I think this should be reversed. https://en.wikipedia.org/w/index.php?title=Draft:Simon_Singer&diff=970407483&oldid=970380461
His common name appears to be Stuffy Singer. --2604:2000:E010:1100:B93E:DEE2:7A52:36D3 (talk) 05:26, 5 August 2020 (UTC)
- Can you please revert it? The name most typically used in reliable sources is generally preferred. Per wp:common name. See here and here and here. Thanks. --2604:2000:E010:1100:718E:144A:FAF4:2D40 (talk) 09:08, 8 August 2020 (UTC)
- Hi. Just following up on the above. 2604:2000:E010:1100:7076:237D:F88C:CC7B (talk) 22:26, 13 August 2020 (UTC)
- Can you please revert? I've contacted you a few times, but have not seen a response. Thanks. 2604:2000:E010:1100:510B:EFF1:6CD6:4E46 (talk) 18:20, 19 August 2020 (UTC)
Thank you
editThank you for clarifying your point of few (LLC28146 (talk) 22:52, 20 August 2020 (UTC))
Comment
editIndeed Losliya Mariyanesan page was deleted twice before any movie announcement but now she has signed two Tamil films in which, one of the movies called Frienship (2020 film) has been released teaser as well Moreover has more than 1M followers for her Instagram verified Id. And as per your comment there is no rules to create Wikipedia page, wait until the release of the movie.. because there are a lot of Wikipedia pages for upcoming movies. Moreover she has gained huge fan base after the [BiggBoss Tamil 3]] LosliyaFC (talk) 15:02, 21 August 2020 (UTC)
Draft: Rajasthan State Open School
editHii,
Sir why are you delete this draft. When I changed all paragraph after you say copyright issues. Please tell me reasons So that i don't repeat such mistake in future Thank youWiki97828 (talk) 01:00, 28 August 2020 (UTC)Wiki97828
You recently reviewed an article I submitted, but I believe it does qualify for a page. Arena Football League is one of the professional leagues in the WP:NGRIDIRON criteria, and 6 games were played during the 1998 season. There is also some confusion because the Iowa Barnstormers were later moved to the AF2 league in 2001, so any games after 2000 would not have qualified for the criteria, but 1998 does qualify. I can share other news articles and clips if more evidence is needed.
Hbomb7 (talk) 18:23, 28 August 2020 (UTC)Hbomb7 Hbomb7 (talk) 18:23, 28 August 2020 (UTC)
Your draft article, Draft:Dr R.Thara
editHello, Dan arndt. It has been over six months since you last edited the Articles for Creation submission or Draft page you started, "Dr R.Thara".
In accordance with our policy that Wikipedia is not for the indefinite hosting of material deemed unsuitable for the encyclopedia mainspace, the draft has been nominated for deletion. If you plan on working on it further, or editing it to address the issues raised if it was declined, simply and remove the {{db-afc}}
, {{db-draft}}
, or {{db-g13}}
code.
If your submission has already been deleted by the time you get there, and you wish to retrieve it, you can request its undeletion by following the instructions at this link. An administrator will, in most cases, restore the submission so you can continue to work on it.
Thank you for your submission to Wikipedia! Lapablo (talk) 08:56, 29 August 2020 (UTC)
Draft: Fidarr
editHello Dan, Updates have been made to this draft and "Unquie sources" have been provided. This brand is just new and may not have several mentions on different web pages. I was able to make 4 references which are very unique to the topic. But I suggest you approve this draft as other updates will be made to the article as the brand grows.
https://en.wikipedia.org/wiki/Draft:Fidarr
Thank you in advance. — Preceding unsigned comment added by Iamurahdavid (talk • contribs) 14:05, 2 September 2020 (UTC)
Dear Dan,
Bob Here, I am doing this article for my artist friend I am doing this for him because to me he is a very important artist and he has been working very hard to this day.
I wanted to do this so I can cheer him up and show my gratitude.
All the info I gave about him is correct, but I am new on wikipedia and new to creating articles and pages so I might did some stuff wrong.
The main idea was to create him a stub info artist bio page. After watching youtube videos about creating articles I think I got a bit excited and decided to right a bigger bio. I am sorry you did not approve this and I would like do my best to get this approved. I went to chat board to get some help and they were so rough with me and broke my heart a bit. I told them I am new and wanted to show them some examples but they did not want to see. They said I need couple of 3rd party source reference and it might get approved after that is provided. can you give me an example of what do I need to show as reference and how many needed? the main idea behind this was to create something like this article below.
https://en.wikipedia.org/wiki/%C5%9Eehin%C5%9Fah
Please let me know what can I do to move forward my article.
Kind Regards,
Bob
Request for assistance on submission by Js2112
editHi Dan,
Thanks for reviewing my submitted article for Theresa Greenfield, which you judged to "[read] like a political election campaign profile." I patterned the article on other articles for similarly situated American politicians, such as John E. James and Jaime Harrison. Could you be more specific on what would make this article less like a campaign profile and more suitable for Wikipedia? The differences from the pages associated with many other politicians are not obvious to me. Greenfield has received extensive coverage in the media ranging from the local to the national level, as indicated in the reference list, which I thought should qualify her as notable based on the "[m]ajor local political figures who have received significant press coverage" criterion.
Thanks, Js2112 (talk) 23:54, 6 September 2020 (UTC)
non wiki version
edithttps://www.flickr.com/photos/satusuro/50329053007/in/dateposted-public/ JarrahTree 03:18, 11 September 2020 (UTC)
Submission about the Southwest coast of Madagascar.
editGood evening Dan,
I am sending you this message to ask you if you could re-review my stub on the Southwest coast of Madagascar. I have added more to it and would love to hear what you think about it.
Thank you,
Lslch — Preceding unsigned comment added by Lslch (talk • contribs) 11:06, 11 September 2020 (UTC)
Redirect
editi wish redirect Draft:Paolo Del Debbio to Draft:Paolo Del Debbio (writer)--Looplips (talk) 07:05, 14 September 2020 (UTC)